Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WQK5

Protein Details
Accession J0WQK5   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-34RVVVKGKRPKTARRNNDEARBasic
NLS Segment(s)
PositionSequence
22-22R
Subcellular Location(s) mito 15, cyto 7.5, cyto_nucl 6, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018593  tRNA-endonuc_su_Sen15  
IPR011856  tRNA_endonuc-like_dom_sf  
IPR036167  tRNA_intron_Endo_cat-like_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0006388  P:tRNA splicing, via endonucleolytic cleavage and ligation  
KEGG adl:AURDEDRAFT_176774  -  
Pfam View protein in Pfam  
PF09631  Sen15  
Amino Acid Sequences MNNPLQPVELPNAGRVVVKGKRPKTARRNNDEARLDNMQYVLPCPLADSLFLAGFGAVFRELEGVSEVHVGICSDDSPVVYYRLSRRIVKPPTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.2
4 0.21
5 0.28
6 0.36
7 0.39
8 0.47
9 0.53
10 0.63
11 0.67
12 0.73
13 0.75
14 0.75
15 0.81
16 0.77
17 0.8
18 0.74
19 0.65
20 0.59
21 0.51
22 0.43
23 0.34
24 0.29
25 0.2
26 0.16
27 0.15
28 0.1
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.05
50 0.06
51 0.06
52 0.06
53 0.07
54 0.07
55 0.06
56 0.07
57 0.06
58 0.05
59 0.06
60 0.06
61 0.06
62 0.06
63 0.07
64 0.09
65 0.1
66 0.11
67 0.11
68 0.15
69 0.19
70 0.27
71 0.31
72 0.36
73 0.41
74 0.49