Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2H622

Protein Details
Accession A0A1X2H622    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-94FLSRITKKSGRRVLQRRLAKGRKNMSHHydrophilic
NLS Segment(s)
PositionSequence
62-91RKRRHGFLSRITKKSGRRVLQRRLAKGRKN
Subcellular Location(s) mito 14, nucl 10, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MAPRALLGAAAARPTVAASTMTASQATPSLLGSSLFSWNPFASTQARFISYGNSYQPSNLVRKRRHGFLSRITKKSGRRVLQRRLAKGRKNMSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.07
4 0.07
5 0.06
6 0.09
7 0.1
8 0.11
9 0.11
10 0.1
11 0.1
12 0.1
13 0.1
14 0.08
15 0.07
16 0.07
17 0.07
18 0.07
19 0.08
20 0.08
21 0.1
22 0.1
23 0.1
24 0.11
25 0.1
26 0.11
27 0.11
28 0.11
29 0.12
30 0.13
31 0.16
32 0.15
33 0.16
34 0.16
35 0.16
36 0.16
37 0.14
38 0.15
39 0.14
40 0.14
41 0.13
42 0.13
43 0.15
44 0.15
45 0.22
46 0.26
47 0.33
48 0.35
49 0.45
50 0.49
51 0.53
52 0.57
53 0.57
54 0.57
55 0.58
56 0.66
57 0.65
58 0.64
59 0.63
60 0.62
61 0.61
62 0.65
63 0.65
64 0.62
65 0.64
66 0.71
67 0.77
68 0.81
69 0.83
70 0.82
71 0.83
72 0.84
73 0.82
74 0.82