Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HDU2

Protein Details
Accession A0A1X2HDU2   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-100NDRLVRRIVRKVDRKQRASRASPDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MVEKGLQLQNKADTIDKKKNMVARLQQEINEYEESHLEYAEQIMDMARKCPYSTQRQRYAVFRTLFKRHNKNAYENDRLVRRIVRKVDRKQRASRASPDTEHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.46
3 0.46
4 0.46
5 0.48
6 0.51
7 0.5
8 0.5
9 0.5
10 0.46
11 0.49
12 0.48
13 0.46
14 0.43
15 0.41
16 0.36
17 0.29
18 0.23
19 0.17
20 0.16
21 0.15
22 0.13
23 0.11
24 0.08
25 0.07
26 0.06
27 0.06
28 0.05
29 0.04
30 0.04
31 0.06
32 0.06
33 0.08
34 0.08
35 0.08
36 0.09
37 0.13
38 0.18
39 0.27
40 0.37
41 0.43
42 0.51
43 0.56
44 0.58
45 0.59
46 0.6
47 0.56
48 0.48
49 0.45
50 0.42
51 0.43
52 0.48
53 0.52
54 0.55
55 0.54
56 0.61
57 0.61
58 0.63
59 0.67
60 0.67
61 0.66
62 0.6
63 0.58
64 0.52
65 0.49
66 0.44
67 0.4
68 0.38
69 0.38
70 0.45
71 0.5
72 0.56
73 0.66
74 0.75
75 0.79
76 0.82
77 0.84
78 0.85
79 0.85
80 0.82
81 0.8
82 0.77
83 0.73