Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HHW6

Protein Details
Accession A0A1X2HHW6    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-44ASFAERAREKRRREEEERRKAQIABasic
66-90ASSTSNKKTPSQAQKRSRNVGKPSPHydrophilic
NLS Segment(s)
PositionSequence
27-40AREKRRREEEERRK
445-464ERRELERLKRLKASKGKVRT
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MDASLDQLMARVTKVASAQDASFAERAREKRRREEEERRKAQIAEYRRQQEERMQAQQNPAKRKTASSTSNKKTPSQAQKRSRNVGKPSPGVDSAAPVRKALKNKDFELPMARKRQESERAAQLSFEELMRKAREVNTPRSASATSASPSVSPGPNTSTSKPNVGQKRPPSVTSATSLSGKRPPPPAPSSSPSLTASSRGPNIYQKRMTGPAHKSDSPAPKGNVSARDMVRQMFREPPQRLNAVKRDRRGVTEIQRDLRHAKGIYSDDEDDVKRSDPRLMKRETTRPVQGQRPLGRPLPPSKPIRSTMNRPNAVRPLSRPSPQQERPAMASKSLPGRPGARVPPRMPFTRADRPLQRDAPLRRSKYEEELDPELADFVVSDEEEEEAYDPRHSYSDEISKIFGYDKKRYRDETFSDDDMEVNTRDLIREEKRSERIGRREDLEEERRELERLKRLKASKGKVRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.17
4 0.19
5 0.19
6 0.22
7 0.23
8 0.24
9 0.24
10 0.23
11 0.23
12 0.28
13 0.34
14 0.4
15 0.48
16 0.51
17 0.6
18 0.69
19 0.75
20 0.79
21 0.84
22 0.84
23 0.87
24 0.88
25 0.84
26 0.77
27 0.69
28 0.65
29 0.61
30 0.58
31 0.56
32 0.58
33 0.59
34 0.6
35 0.61
36 0.57
37 0.57
38 0.59
39 0.56
40 0.56
41 0.54
42 0.53
43 0.6
44 0.62
45 0.61
46 0.6
47 0.57
48 0.54
49 0.5
50 0.51
51 0.49
52 0.54
53 0.56
54 0.57
55 0.64
56 0.65
57 0.71
58 0.69
59 0.65
60 0.64
61 0.64
62 0.65
63 0.66
64 0.69
65 0.73
66 0.8
67 0.86
68 0.88
69 0.86
70 0.84
71 0.81
72 0.8
73 0.77
74 0.72
75 0.65
76 0.6
77 0.52
78 0.46
79 0.37
80 0.32
81 0.3
82 0.32
83 0.3
84 0.26
85 0.3
86 0.32
87 0.39
88 0.45
89 0.47
90 0.46
91 0.49
92 0.55
93 0.52
94 0.5
95 0.52
96 0.49
97 0.47
98 0.5
99 0.49
100 0.44
101 0.46
102 0.52
103 0.52
104 0.51
105 0.49
106 0.49
107 0.51
108 0.49
109 0.46
110 0.38
111 0.3
112 0.26
113 0.21
114 0.14
115 0.11
116 0.16
117 0.17
118 0.17
119 0.17
120 0.2
121 0.29
122 0.33
123 0.4
124 0.44
125 0.44
126 0.44
127 0.44
128 0.41
129 0.33
130 0.29
131 0.23
132 0.16
133 0.15
134 0.15
135 0.12
136 0.13
137 0.15
138 0.15
139 0.13
140 0.14
141 0.16
142 0.22
143 0.25
144 0.27
145 0.29
146 0.3
147 0.33
148 0.35
149 0.4
150 0.43
151 0.46
152 0.51
153 0.52
154 0.6
155 0.58
156 0.56
157 0.52
158 0.46
159 0.42
160 0.36
161 0.32
162 0.24
163 0.25
164 0.24
165 0.23
166 0.26
167 0.26
168 0.27
169 0.3
170 0.32
171 0.35
172 0.39
173 0.41
174 0.41
175 0.42
176 0.43
177 0.39
178 0.38
179 0.33
180 0.31
181 0.26
182 0.22
183 0.21
184 0.19
185 0.19
186 0.17
187 0.17
188 0.23
189 0.27
190 0.32
191 0.32
192 0.31
193 0.32
194 0.37
195 0.38
196 0.38
197 0.37
198 0.38
199 0.41
200 0.4
201 0.39
202 0.4
203 0.45
204 0.41
205 0.41
206 0.35
207 0.31
208 0.33
209 0.34
210 0.31
211 0.26
212 0.27
213 0.23
214 0.25
215 0.25
216 0.24
217 0.23
218 0.21
219 0.2
220 0.2
221 0.23
222 0.29
223 0.3
224 0.33
225 0.34
226 0.37
227 0.37
228 0.38
229 0.43
230 0.45
231 0.48
232 0.46
233 0.49
234 0.47
235 0.47
236 0.46
237 0.43
238 0.42
239 0.45
240 0.46
241 0.45
242 0.44
243 0.43
244 0.41
245 0.36
246 0.31
247 0.22
248 0.19
249 0.19
250 0.2
251 0.2
252 0.21
253 0.21
254 0.18
255 0.19
256 0.19
257 0.16
258 0.15
259 0.15
260 0.13
261 0.13
262 0.18
263 0.22
264 0.29
265 0.35
266 0.39
267 0.43
268 0.48
269 0.56
270 0.54
271 0.54
272 0.53
273 0.52
274 0.53
275 0.54
276 0.53
277 0.53
278 0.54
279 0.53
280 0.5
281 0.47
282 0.45
283 0.43
284 0.43
285 0.42
286 0.43
287 0.44
288 0.45
289 0.47
290 0.47
291 0.52
292 0.52
293 0.53
294 0.56
295 0.61
296 0.62
297 0.58
298 0.6
299 0.58
300 0.55
301 0.5
302 0.43
303 0.41
304 0.41
305 0.42
306 0.42
307 0.41
308 0.48
309 0.5
310 0.55
311 0.51
312 0.49
313 0.51
314 0.53
315 0.48
316 0.4
317 0.36
318 0.31
319 0.33
320 0.32
321 0.29
322 0.24
323 0.26
324 0.28
325 0.33
326 0.39
327 0.4
328 0.45
329 0.45
330 0.51
331 0.53
332 0.53
333 0.5
334 0.46
335 0.46
336 0.49
337 0.52
338 0.51
339 0.54
340 0.57
341 0.62
342 0.61
343 0.57
344 0.55
345 0.57
346 0.6
347 0.61
348 0.59
349 0.54
350 0.57
351 0.56
352 0.55
353 0.54
354 0.48
355 0.45
356 0.45
357 0.43
358 0.36
359 0.33
360 0.25
361 0.2
362 0.16
363 0.09
364 0.06
365 0.06
366 0.05
367 0.06
368 0.06
369 0.06
370 0.06
371 0.07
372 0.07
373 0.08
374 0.09
375 0.1
376 0.1
377 0.11
378 0.13
379 0.13
380 0.14
381 0.19
382 0.26
383 0.28
384 0.29
385 0.29
386 0.28
387 0.28
388 0.29
389 0.28
390 0.26
391 0.33
392 0.4
393 0.47
394 0.53
395 0.59
396 0.62
397 0.66
398 0.65
399 0.63
400 0.61
401 0.54
402 0.51
403 0.45
404 0.39
405 0.32
406 0.29
407 0.21
408 0.16
409 0.16
410 0.13
411 0.13
412 0.15
413 0.21
414 0.23
415 0.32
416 0.36
417 0.43
418 0.48
419 0.55
420 0.62
421 0.65
422 0.69
423 0.68
424 0.68
425 0.65
426 0.63
427 0.61
428 0.61
429 0.6
430 0.54
431 0.5
432 0.48
433 0.45
434 0.43
435 0.43
436 0.42
437 0.43
438 0.46
439 0.49
440 0.54
441 0.58
442 0.66
443 0.71
444 0.73