Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HGT0

Protein Details
Accession A0A1X2HGT0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-75ITARSSTAGNQKKKKKDVQDLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 7, plas 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MPRRGALVLIALVPKVCWPVYCFLEVSVQTSSLSLRCQKRGFTLLAAWRSQMKAITARSSTAGNQKKKKKDVQDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.09
5 0.11
6 0.16
7 0.18
8 0.19
9 0.19
10 0.17
11 0.21
12 0.2
13 0.21
14 0.16
15 0.15
16 0.13
17 0.13
18 0.12
19 0.09
20 0.11
21 0.15
22 0.18
23 0.22
24 0.23
25 0.24
26 0.27
27 0.29
28 0.28
29 0.23
30 0.25
31 0.26
32 0.27
33 0.27
34 0.24
35 0.23
36 0.22
37 0.21
38 0.18
39 0.14
40 0.17
41 0.19
42 0.23
43 0.23
44 0.23
45 0.24
46 0.24
47 0.25
48 0.3
49 0.37
50 0.41
51 0.5
52 0.58
53 0.67
54 0.74
55 0.81