Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0D116

Protein Details
Accession J0D116    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
203-228CRVWTRRSGAGPRRIRRKRGGGQEASHydrophilic
NLS Segment(s)
PositionSequence
209-222RSGAGPRRIRRKRG
Subcellular Location(s) nucl 13, cyto 8, extr 3, pero 2
Family & Domain DBs
KEGG adl:AURDEDRAFT_118172  -  
Amino Acid Sequences MPGLTAVDLEPHSALIASAFLPQEAAFAGAARDSVWYKAVIPDAIPPDPSQPLPSSQVLQAEVEDYVHHRFSWAAPPIWLTPAGRVAEEGSGSVLLSFLREEDLEYVLRNGVFLFGRALRVRRFRDSGRPRPCSNCCSLEHSAHACSQAPRCGLCSGGHLTSEHRCGECDFFDDAHESLAHCGHTALCCPHCAGSHAMYDSACRVWTRRSGAGPRRIRRKRGGGQEASAMDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.06
3 0.07
4 0.06
5 0.09
6 0.09
7 0.09
8 0.09
9 0.09
10 0.09
11 0.09
12 0.09
13 0.06
14 0.06
15 0.07
16 0.06
17 0.06
18 0.06
19 0.08
20 0.08
21 0.09
22 0.1
23 0.11
24 0.12
25 0.14
26 0.16
27 0.15
28 0.14
29 0.18
30 0.21
31 0.21
32 0.21
33 0.19
34 0.2
35 0.22
36 0.22
37 0.2
38 0.17
39 0.19
40 0.23
41 0.24
42 0.23
43 0.22
44 0.24
45 0.22
46 0.21
47 0.18
48 0.14
49 0.12
50 0.11
51 0.09
52 0.09
53 0.1
54 0.11
55 0.1
56 0.1
57 0.1
58 0.12
59 0.19
60 0.21
61 0.2
62 0.19
63 0.22
64 0.22
65 0.23
66 0.23
67 0.15
68 0.12
69 0.16
70 0.16
71 0.14
72 0.14
73 0.13
74 0.12
75 0.12
76 0.11
77 0.06
78 0.06
79 0.06
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.03
86 0.04
87 0.04
88 0.05
89 0.06
90 0.07
91 0.07
92 0.07
93 0.08
94 0.08
95 0.07
96 0.07
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.09
104 0.1
105 0.13
106 0.15
107 0.22
108 0.25
109 0.28
110 0.32
111 0.32
112 0.42
113 0.5
114 0.56
115 0.59
116 0.61
117 0.59
118 0.62
119 0.64
120 0.57
121 0.52
122 0.46
123 0.39
124 0.41
125 0.41
126 0.36
127 0.35
128 0.32
129 0.29
130 0.25
131 0.24
132 0.19
133 0.18
134 0.19
135 0.2
136 0.19
137 0.18
138 0.19
139 0.19
140 0.18
141 0.17
142 0.18
143 0.17
144 0.17
145 0.17
146 0.15
147 0.17
148 0.19
149 0.22
150 0.2
151 0.17
152 0.17
153 0.18
154 0.2
155 0.18
156 0.19
157 0.17
158 0.15
159 0.16
160 0.17
161 0.16
162 0.14
163 0.14
164 0.11
165 0.1
166 0.11
167 0.1
168 0.08
169 0.09
170 0.09
171 0.09
172 0.12
173 0.16
174 0.16
175 0.17
176 0.17
177 0.19
178 0.19
179 0.2
180 0.21
181 0.19
182 0.22
183 0.22
184 0.22
185 0.2
186 0.2
187 0.2
188 0.17
189 0.16
190 0.13
191 0.14
192 0.18
193 0.25
194 0.3
195 0.34
196 0.4
197 0.49
198 0.58
199 0.66
200 0.72
201 0.74
202 0.79
203 0.82
204 0.83
205 0.82
206 0.84
207 0.83
208 0.84
209 0.85
210 0.8
211 0.74
212 0.73
213 0.63