Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2H013

Protein Details
Accession A0A1X2H013    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-40GVPMVKRKKPKGESLIRPFRGBasic
NLS Segment(s)
PositionSequence
25-39KRKKPKGESLIRPFR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001087  GDSL  
Gene Ontology GO:0016788  F:hydrolase activity, acting on ester bonds  
Pfam View protein in Pfam  
PF00657  Lipase_GDSL  
Amino Acid Sequences MIGTDKTEDWVVMDLYGTLGVPMVKRKKPKGESLIRPFRGHRQKIANTFSLKYCTDASCPSKFVMQMQLRKLETNVDQMLDIVNEDDYFNTAQSGATNRNFTQQVQYLIERIGSGTSLDDEWKVLTIFLGSNDVVFACLPGFSAAEHEERMRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.07
5 0.05
6 0.05
7 0.06
8 0.07
9 0.15
10 0.23
11 0.29
12 0.37
13 0.45
14 0.55
15 0.6
16 0.69
17 0.71
18 0.73
19 0.78
20 0.81
21 0.84
22 0.77
23 0.74
24 0.66
25 0.66
26 0.66
27 0.59
28 0.55
29 0.54
30 0.57
31 0.62
32 0.65
33 0.6
34 0.52
35 0.51
36 0.45
37 0.4
38 0.33
39 0.27
40 0.25
41 0.2
42 0.19
43 0.23
44 0.26
45 0.24
46 0.25
47 0.23
48 0.23
49 0.22
50 0.21
51 0.25
52 0.26
53 0.3
54 0.31
55 0.36
56 0.35
57 0.35
58 0.34
59 0.27
60 0.23
61 0.22
62 0.2
63 0.14
64 0.14
65 0.13
66 0.13
67 0.1
68 0.09
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.09
82 0.12
83 0.14
84 0.17
85 0.17
86 0.22
87 0.23
88 0.22
89 0.25
90 0.24
91 0.26
92 0.26
93 0.26
94 0.22
95 0.22
96 0.21
97 0.16
98 0.13
99 0.09
100 0.07
101 0.06
102 0.06
103 0.07
104 0.07
105 0.08
106 0.08
107 0.08
108 0.08
109 0.09
110 0.08
111 0.07
112 0.07
113 0.07
114 0.08
115 0.08
116 0.11
117 0.09
118 0.09
119 0.09
120 0.09
121 0.09
122 0.08
123 0.08
124 0.05
125 0.05
126 0.06
127 0.07
128 0.07
129 0.06
130 0.1
131 0.12
132 0.14
133 0.16
134 0.17