Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0CV72

Protein Details
Accession J0CV72    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPPRRAPRKQAGKKPGGRRNAASBasic
57-84APPAPPLPPVKKPKKKAASKGKGKGKAVBasic
NLS Segment(s)
PositionSequence
3-82PRRAPRKQAGKKPGGRRNAASPPPPPPNPPGGKKGKAAPAGPSRVLRSGKKGPAAPPAPPLPPVKKPKKKAASKGKGKGK
116-147AKGKGKGKAAPKAAPKAAPKPAAKKTSRKRAR
Subcellular Location(s) nucl 17, mito 6, cyto 4
Family & Domain DBs
KEGG adl:AURDEDRAFT_176648  -  
Amino Acid Sequences MPPRRAPRKQAGKKPGGRRNAASPPPPPPNPPGGKKGKAAPAGPSRVLRSGKKGPAAPPAPPLPPVKKPKKKAASKGKGKGKAVQVSDEEEEEDEEEEEPDDGEDDDEPELEPEPAKGKGKGKAAPKAAPKAAPKPAAKKTSRKRARADSDVDDVDDAPKVVKRSKRYVDPREGKDEEEPTSGPEHEAPSGSSKAQQKRAAPKEADVATDWSHFDRNRKPGPTEAQIPVAAQAIVSGGMKTYLPLHTFADEVLEAERTSRIVVINGAQPSNNVSVHVREGEMSMLHWTKWGKRLLVALSKLTRNPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.89
3 0.86
4 0.82
5 0.76
6 0.74
7 0.73
8 0.71
9 0.66
10 0.61
11 0.6
12 0.63
13 0.61
14 0.57
15 0.51
16 0.54
17 0.56
18 0.58
19 0.59
20 0.6
21 0.61
22 0.61
23 0.64
24 0.62
25 0.6
26 0.56
27 0.55
28 0.54
29 0.55
30 0.54
31 0.5
32 0.45
33 0.46
34 0.49
35 0.44
36 0.43
37 0.47
38 0.49
39 0.52
40 0.53
41 0.49
42 0.54
43 0.54
44 0.48
45 0.44
46 0.42
47 0.38
48 0.37
49 0.4
50 0.36
51 0.42
52 0.51
53 0.56
54 0.62
55 0.68
56 0.75
57 0.8
58 0.84
59 0.86
60 0.87
61 0.86
62 0.87
63 0.9
64 0.89
65 0.86
66 0.79
67 0.75
68 0.71
69 0.67
70 0.58
71 0.52
72 0.43
73 0.39
74 0.38
75 0.31
76 0.24
77 0.17
78 0.16
79 0.12
80 0.11
81 0.08
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.08
102 0.11
103 0.13
104 0.17
105 0.2
106 0.25
107 0.31
108 0.35
109 0.39
110 0.44
111 0.46
112 0.48
113 0.49
114 0.49
115 0.45
116 0.45
117 0.43
118 0.41
119 0.43
120 0.44
121 0.42
122 0.43
123 0.49
124 0.53
125 0.54
126 0.58
127 0.61
128 0.65
129 0.71
130 0.71
131 0.7
132 0.71
133 0.73
134 0.69
135 0.65
136 0.57
137 0.51
138 0.45
139 0.38
140 0.29
141 0.22
142 0.16
143 0.11
144 0.08
145 0.05
146 0.06
147 0.08
148 0.12
149 0.17
150 0.22
151 0.3
152 0.35
153 0.44
154 0.53
155 0.59
156 0.66
157 0.69
158 0.68
159 0.68
160 0.64
161 0.56
162 0.49
163 0.43
164 0.35
165 0.28
166 0.24
167 0.17
168 0.18
169 0.16
170 0.14
171 0.13
172 0.12
173 0.11
174 0.11
175 0.11
176 0.13
177 0.14
178 0.13
179 0.17
180 0.23
181 0.29
182 0.37
183 0.41
184 0.44
185 0.53
186 0.59
187 0.61
188 0.55
189 0.51
190 0.5
191 0.46
192 0.41
193 0.31
194 0.27
195 0.21
196 0.21
197 0.2
198 0.15
199 0.18
200 0.18
201 0.23
202 0.28
203 0.35
204 0.41
205 0.45
206 0.46
207 0.49
208 0.54
209 0.53
210 0.52
211 0.45
212 0.41
213 0.37
214 0.35
215 0.29
216 0.23
217 0.17
218 0.11
219 0.09
220 0.06
221 0.06
222 0.06
223 0.05
224 0.04
225 0.05
226 0.06
227 0.06
228 0.08
229 0.11
230 0.12
231 0.14
232 0.16
233 0.16
234 0.16
235 0.15
236 0.16
237 0.12
238 0.12
239 0.11
240 0.1
241 0.09
242 0.1
243 0.1
244 0.08
245 0.09
246 0.1
247 0.09
248 0.09
249 0.11
250 0.13
251 0.18
252 0.2
253 0.2
254 0.19
255 0.19
256 0.21
257 0.23
258 0.2
259 0.17
260 0.16
261 0.18
262 0.21
263 0.22
264 0.2
265 0.17
266 0.17
267 0.17
268 0.15
269 0.13
270 0.16
271 0.16
272 0.16
273 0.19
274 0.21
275 0.25
276 0.32
277 0.37
278 0.33
279 0.35
280 0.41
281 0.45
282 0.51
283 0.48
284 0.49
285 0.49
286 0.51