Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0DA44

Protein Details
Accession J0DA44    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-103SLLGARWMKHKDRRRAGQQNAHLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 6.833, mito 6.5, cyto 6, pero 6, cyto_nucl 5.833, nucl 4.5, cysk 4
Family & Domain DBs
KEGG adl:AURDEDRAFT_25106  -  
Amino Acid Sequences VRVATLLRNGGVVYELDSKESAEWVRKPMIRSLFLQRFDPSAILRDRAHPVLLKNVPVEFDVSSTEFLRGIETANELPEHSLLGARWMKHKDRRRAGQQNAHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.17
5 0.17
6 0.16
7 0.18
8 0.17
9 0.16
10 0.18
11 0.2
12 0.27
13 0.29
14 0.31
15 0.35
16 0.39
17 0.35
18 0.37
19 0.43
20 0.44
21 0.42
22 0.43
23 0.37
24 0.33
25 0.31
26 0.29
27 0.19
28 0.17
29 0.16
30 0.17
31 0.17
32 0.18
33 0.21
34 0.2
35 0.21
36 0.17
37 0.17
38 0.22
39 0.22
40 0.2
41 0.18
42 0.17
43 0.17
44 0.16
45 0.17
46 0.09
47 0.09
48 0.09
49 0.09
50 0.11
51 0.1
52 0.1
53 0.09
54 0.09
55 0.1
56 0.08
57 0.08
58 0.08
59 0.09
60 0.1
61 0.1
62 0.11
63 0.1
64 0.11
65 0.1
66 0.09
67 0.07
68 0.08
69 0.07
70 0.14
71 0.18
72 0.18
73 0.25
74 0.3
75 0.38
76 0.47
77 0.57
78 0.61
79 0.68
80 0.77
81 0.82
82 0.86
83 0.88