Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J0D2P9

Protein Details
Accession J0D2P9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
29-52STGRAPKTSARRRQDQRARQTPLAHydrophilic
NLS Segment(s)
PositionSequence
39-42RRRQ
45-46RA
53-54RP
59-64ERRIRP
Subcellular Location(s) mito 15, extr 5, cyto 4, pero 2
Family & Domain DBs
KEGG adl:AURDEDRAFT_115463  -  
Amino Acid Sequences MPLTPKNIPVIVVTSPSGTLAPWSCLQPSTGRAPKTSARRRQDQRARQTPLARPAPDSERRIRPSRPAPAPPAIVDVRINVERTGAVLVLRVPQASSLDCLRARLPPAARGQLAMADESVERWALESHFHAFLARAHRDREPLRLVLQEYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.14
5 0.1
6 0.12
7 0.11
8 0.14
9 0.15
10 0.16
11 0.17
12 0.17
13 0.18
14 0.18
15 0.2
16 0.26
17 0.31
18 0.31
19 0.31
20 0.35
21 0.4
22 0.48
23 0.55
24 0.55
25 0.56
26 0.65
27 0.71
28 0.78
29 0.82
30 0.81
31 0.81
32 0.81
33 0.81
34 0.77
35 0.76
36 0.7
37 0.69
38 0.65
39 0.55
40 0.47
41 0.43
42 0.45
43 0.45
44 0.44
45 0.41
46 0.43
47 0.47
48 0.5
49 0.48
50 0.49
51 0.5
52 0.54
53 0.53
54 0.5
55 0.49
56 0.48
57 0.47
58 0.4
59 0.36
60 0.27
61 0.23
62 0.19
63 0.14
64 0.14
65 0.13
66 0.14
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.06
73 0.05
74 0.05
75 0.05
76 0.07
77 0.07
78 0.07
79 0.06
80 0.07
81 0.08
82 0.08
83 0.1
84 0.09
85 0.13
86 0.13
87 0.15
88 0.15
89 0.16
90 0.18
91 0.22
92 0.22
93 0.24
94 0.29
95 0.31
96 0.31
97 0.29
98 0.27
99 0.24
100 0.23
101 0.18
102 0.13
103 0.1
104 0.09
105 0.09
106 0.1
107 0.07
108 0.06
109 0.07
110 0.08
111 0.08
112 0.1
113 0.12
114 0.15
115 0.15
116 0.16
117 0.15
118 0.15
119 0.19
120 0.24
121 0.29
122 0.29
123 0.31
124 0.34
125 0.42
126 0.43
127 0.47
128 0.44
129 0.4
130 0.4
131 0.42