Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0D1U3

Protein Details
Accession J0D1U3    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
168-195ATVTALSLARKRRRRREHRDAPPPPYTAHydrophilic
NLS Segment(s)
PositionSequence
177-187RKRRRRREHRD
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, mito 4, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG adl:AURDEDRAFT_178354  -  
Amino Acid Sequences MSDILIEDDDERHVSYYPAGAWEFLSESKYHASTYHMTSTPGAYMTFTFSGSFVEYYSDLHNDHGAFTASLDGEVVFSASSQSKTLLEQRVLFSSAVSPGHHVLTITNGKDMRVTGVDYFVYRGDSNNTKINIETDGHAAVSWTTVAQAHRSQAISTCVAFALLISLATVTALSLARKRRRRREHRDAPPPPYTAPPQLRPPASHDDRHEGLVQNIVDARRDKLRNLGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.13
5 0.15
6 0.14
7 0.14
8 0.13
9 0.14
10 0.15
11 0.14
12 0.15
13 0.12
14 0.13
15 0.16
16 0.16
17 0.16
18 0.15
19 0.18
20 0.21
21 0.25
22 0.29
23 0.27
24 0.28
25 0.28
26 0.28
27 0.25
28 0.22
29 0.17
30 0.12
31 0.11
32 0.13
33 0.13
34 0.13
35 0.12
36 0.11
37 0.12
38 0.12
39 0.12
40 0.08
41 0.1
42 0.09
43 0.1
44 0.12
45 0.13
46 0.12
47 0.12
48 0.14
49 0.12
50 0.13
51 0.12
52 0.11
53 0.1
54 0.09
55 0.1
56 0.08
57 0.07
58 0.07
59 0.06
60 0.05
61 0.05
62 0.05
63 0.03
64 0.03
65 0.05
66 0.06
67 0.07
68 0.07
69 0.08
70 0.09
71 0.11
72 0.17
73 0.2
74 0.2
75 0.22
76 0.23
77 0.23
78 0.25
79 0.23
80 0.17
81 0.13
82 0.13
83 0.12
84 0.11
85 0.11
86 0.1
87 0.1
88 0.1
89 0.09
90 0.08
91 0.11
92 0.15
93 0.13
94 0.15
95 0.15
96 0.15
97 0.15
98 0.15
99 0.12
100 0.09
101 0.1
102 0.08
103 0.09
104 0.09
105 0.08
106 0.09
107 0.08
108 0.09
109 0.08
110 0.08
111 0.11
112 0.13
113 0.16
114 0.2
115 0.21
116 0.19
117 0.2
118 0.2
119 0.18
120 0.16
121 0.15
122 0.11
123 0.11
124 0.1
125 0.1
126 0.09
127 0.07
128 0.06
129 0.05
130 0.04
131 0.04
132 0.06
133 0.06
134 0.09
135 0.11
136 0.12
137 0.15
138 0.15
139 0.15
140 0.16
141 0.18
142 0.17
143 0.15
144 0.15
145 0.12
146 0.11
147 0.11
148 0.08
149 0.06
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.03
158 0.04
159 0.05
160 0.06
161 0.11
162 0.2
163 0.3
164 0.39
165 0.5
166 0.59
167 0.7
168 0.8
169 0.86
170 0.89
171 0.91
172 0.93
173 0.94
174 0.91
175 0.87
176 0.81
177 0.73
178 0.63
179 0.57
180 0.51
181 0.49
182 0.48
183 0.46
184 0.49
185 0.54
186 0.55
187 0.52
188 0.54
189 0.54
190 0.53
191 0.54
192 0.51
193 0.51
194 0.49
195 0.5
196 0.48
197 0.39
198 0.35
199 0.34
200 0.29
201 0.23
202 0.25
203 0.23
204 0.23
205 0.23
206 0.25
207 0.29
208 0.31
209 0.31