Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HA01

Protein Details
Accession A0A1X2HA01   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-37LALVLKKITRKGTRKNFRLKKGPAPHVEDHydrophilic
NLS Segment(s)
PositionSequence
15-30KITRKGTRKNFRLKKG
Subcellular Location(s) nucl 12, mito_nucl 11.666, mito 10, cyto_nucl 7.666, cyto_mito 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR036028  SH3-like_dom_sf  
IPR001452  SH3_domain  
Pfam View protein in Pfam  
PF00018  SH3_1  
PROSITE View protein in PROSITE  
PS50002  SH3  
Amino Acid Sequences MSLSTVITLALVLKKITRKGTRKNFRLKKGPAPHVEDDDDQDSYSSAEEKIDCSSPSPPVLKNEIQYTKDTKHPASSAQPSTASLPSPPAEQADPCCQETVLTADDVINKDNGAETPDLLNKAKEGQDETEEGQVVIRDFAYPITSPLHHGRAEESRSSRSSQVSLSSSEFTGRHGRALYDFSPETEYEIGMKAGQLVWVQYRQCPGWLVADVEDETGLIPESYIEFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.35
4 0.42
5 0.49
6 0.59
7 0.7
8 0.77
9 0.81
10 0.87
11 0.88
12 0.88
13 0.89
14 0.85
15 0.85
16 0.84
17 0.84
18 0.8
19 0.78
20 0.72
21 0.66
22 0.63
23 0.53
24 0.47
25 0.4
26 0.33
27 0.25
28 0.21
29 0.17
30 0.13
31 0.12
32 0.09
33 0.07
34 0.08
35 0.09
36 0.1
37 0.12
38 0.14
39 0.14
40 0.15
41 0.16
42 0.17
43 0.21
44 0.22
45 0.22
46 0.24
47 0.3
48 0.31
49 0.31
50 0.36
51 0.38
52 0.38
53 0.39
54 0.39
55 0.36
56 0.39
57 0.4
58 0.34
59 0.32
60 0.31
61 0.31
62 0.33
63 0.38
64 0.34
65 0.32
66 0.31
67 0.28
68 0.3
69 0.27
70 0.21
71 0.14
72 0.14
73 0.13
74 0.13
75 0.13
76 0.12
77 0.11
78 0.12
79 0.15
80 0.19
81 0.21
82 0.21
83 0.2
84 0.19
85 0.18
86 0.18
87 0.16
88 0.11
89 0.08
90 0.07
91 0.08
92 0.1
93 0.1
94 0.1
95 0.08
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.06
102 0.06
103 0.08
104 0.09
105 0.11
106 0.11
107 0.11
108 0.09
109 0.12
110 0.12
111 0.12
112 0.13
113 0.12
114 0.14
115 0.15
116 0.16
117 0.15
118 0.14
119 0.13
120 0.11
121 0.1
122 0.09
123 0.07
124 0.06
125 0.05
126 0.05
127 0.05
128 0.07
129 0.06
130 0.08
131 0.1
132 0.1
133 0.13
134 0.17
135 0.2
136 0.19
137 0.19
138 0.21
139 0.25
140 0.28
141 0.29
142 0.29
143 0.29
144 0.3
145 0.32
146 0.32
147 0.28
148 0.26
149 0.22
150 0.24
151 0.22
152 0.23
153 0.22
154 0.21
155 0.2
156 0.21
157 0.19
158 0.18
159 0.24
160 0.21
161 0.22
162 0.21
163 0.22
164 0.21
165 0.26
166 0.24
167 0.22
168 0.22
169 0.21
170 0.23
171 0.22
172 0.23
173 0.18
174 0.18
175 0.13
176 0.14
177 0.13
178 0.1
179 0.1
180 0.08
181 0.08
182 0.1
183 0.09
184 0.1
185 0.13
186 0.18
187 0.19
188 0.2
189 0.24
190 0.23
191 0.25
192 0.25
193 0.23
194 0.23
195 0.24
196 0.23
197 0.2
198 0.22
199 0.2
200 0.18
201 0.17
202 0.12
203 0.11
204 0.09
205 0.09
206 0.06
207 0.05
208 0.06