Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HAS6

Protein Details
Accession A0A1X2HAS6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGPCKSRKQSTYPRKPVRLCIAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MGPCKSRKQSTYPRKPVRLCIAILSNASGTLCCPDAAGRNFVDAYITPAVFCDQLTNCRKDTWVSCKTGEVELGMLLMVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.79
5 0.72
6 0.61
7 0.54
8 0.47
9 0.4
10 0.37
11 0.29
12 0.2
13 0.16
14 0.14
15 0.1
16 0.07
17 0.07
18 0.07
19 0.06
20 0.06
21 0.06
22 0.12
23 0.14
24 0.16
25 0.15
26 0.15
27 0.15
28 0.14
29 0.15
30 0.09
31 0.11
32 0.1
33 0.1
34 0.09
35 0.09
36 0.1
37 0.1
38 0.1
39 0.09
40 0.09
41 0.18
42 0.23
43 0.26
44 0.26
45 0.27
46 0.28
47 0.29
48 0.34
49 0.35
50 0.37
51 0.38
52 0.38
53 0.41
54 0.42
55 0.4
56 0.34
57 0.26
58 0.19
59 0.15
60 0.14