Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HT39

Protein Details
Accession A0A1X2HT39    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
56-87LEDSCVSYVRRKRPEKKNGKNQKAIQKQKQKSHydrophilic
NLS Segment(s)
PositionSequence
65-87RRKRPEKKNGKNQKAIQKQKQKS
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MPFNAKAEDDVKASDPQTPLPKTRSKYVKNACTNCRKASRKCDDARPCPRCIKYALEDSCVSYVRRKRPEKKNGKNQKAIQKQKQKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.25
4 0.31
5 0.32
6 0.34
7 0.36
8 0.43
9 0.42
10 0.5
11 0.55
12 0.52
13 0.59
14 0.64
15 0.69
16 0.71
17 0.75
18 0.74
19 0.74
20 0.73
21 0.68
22 0.69
23 0.66
24 0.63
25 0.66
26 0.66
27 0.65
28 0.64
29 0.68
30 0.67
31 0.7
32 0.74
33 0.68
34 0.64
35 0.62
36 0.59
37 0.51
38 0.46
39 0.41
40 0.35
41 0.4
42 0.38
43 0.35
44 0.34
45 0.33
46 0.32
47 0.29
48 0.25
49 0.23
50 0.29
51 0.34
52 0.44
53 0.53
54 0.61
55 0.7
56 0.81
57 0.85
58 0.89
59 0.91
60 0.93
61 0.93
62 0.93
63 0.9
64 0.9
65 0.89
66 0.89
67 0.88