Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2H4T0

Protein Details
Accession A0A1X2H4T0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
207-226ADKRERAAKREKAKQQQQEQHydrophilic
NLS Segment(s)
PositionSequence
136-220KARLAEKRALKAKQEEEEKRQSEKIRRKTGQEITDARAKMEEKEIKKAFEAKRREKEQDRLAKAKIKAQIEADKRERAAKREKAK
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 10.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015940  UBA  
IPR009060  UBA-like_sf  
IPR029071  Ubiquitin-like_domsf  
IPR001012  UBX_dom  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00627  UBA  
PF00789  UBX  
PROSITE View protein in PROSITE  
PS50030  UBA  
PS50033  UBX  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MASDKDTLVSMGFSPAKVQKAWKATNGAGLQPAMDWLLEHPEVSDEPDPEEEGQSLTSTTTTSAPAGSTDNEEGEIKDGEQTAQSLMCNDCSKLFRDPASAERHAIRTSHQNFSESTEAIAPLTEEEKAAKLAELKARLAEKRALKAKQEEEEKRQSEKIRRKTGQEITDARAKMEEKEIKKAFEAKRREKEQDRLAKAKIKAQIEADKRERAAKREKAKQQQQEQQEQAQASAAAAAAASAPGVKKEYNEARLQFRVPGSGPLTQTFAADATLDEVYQYLKLQGCNEPFTLSTTFPRKTFAERDMSKSLKELNLVPSSALVLAYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.26
4 0.27
5 0.31
6 0.32
7 0.41
8 0.45
9 0.46
10 0.48
11 0.46
12 0.52
13 0.49
14 0.43
15 0.36
16 0.32
17 0.26
18 0.2
19 0.2
20 0.12
21 0.1
22 0.08
23 0.07
24 0.12
25 0.12
26 0.12
27 0.12
28 0.13
29 0.14
30 0.18
31 0.2
32 0.15
33 0.17
34 0.18
35 0.19
36 0.18
37 0.19
38 0.15
39 0.13
40 0.13
41 0.11
42 0.1
43 0.09
44 0.08
45 0.07
46 0.08
47 0.09
48 0.09
49 0.09
50 0.1
51 0.1
52 0.1
53 0.12
54 0.12
55 0.14
56 0.14
57 0.14
58 0.14
59 0.15
60 0.14
61 0.14
62 0.14
63 0.1
64 0.11
65 0.11
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.09
72 0.1
73 0.1
74 0.13
75 0.14
76 0.14
77 0.16
78 0.17
79 0.2
80 0.22
81 0.25
82 0.22
83 0.25
84 0.26
85 0.29
86 0.35
87 0.33
88 0.31
89 0.31
90 0.32
91 0.29
92 0.27
93 0.23
94 0.26
95 0.29
96 0.33
97 0.32
98 0.31
99 0.3
100 0.34
101 0.35
102 0.25
103 0.21
104 0.16
105 0.15
106 0.13
107 0.13
108 0.08
109 0.06
110 0.06
111 0.06
112 0.05
113 0.06
114 0.06
115 0.07
116 0.07
117 0.07
118 0.08
119 0.12
120 0.15
121 0.17
122 0.16
123 0.18
124 0.21
125 0.21
126 0.22
127 0.24
128 0.23
129 0.28
130 0.34
131 0.34
132 0.34
133 0.4
134 0.41
135 0.41
136 0.47
137 0.45
138 0.45
139 0.51
140 0.5
141 0.47
142 0.47
143 0.46
144 0.47
145 0.52
146 0.55
147 0.57
148 0.57
149 0.59
150 0.63
151 0.64
152 0.59
153 0.56
154 0.5
155 0.42
156 0.45
157 0.41
158 0.33
159 0.28
160 0.24
161 0.19
162 0.23
163 0.27
164 0.23
165 0.32
166 0.33
167 0.32
168 0.33
169 0.4
170 0.38
171 0.41
172 0.48
173 0.49
174 0.57
175 0.61
176 0.67
177 0.65
178 0.67
179 0.68
180 0.68
181 0.65
182 0.6
183 0.57
184 0.57
185 0.52
186 0.5
187 0.46
188 0.38
189 0.34
190 0.34
191 0.39
192 0.37
193 0.44
194 0.42
195 0.39
196 0.39
197 0.44
198 0.43
199 0.4
200 0.46
201 0.46
202 0.51
203 0.59
204 0.67
205 0.7
206 0.77
207 0.8
208 0.8
209 0.79
210 0.77
211 0.76
212 0.7
213 0.62
214 0.57
215 0.48
216 0.38
217 0.31
218 0.24
219 0.15
220 0.12
221 0.09
222 0.05
223 0.04
224 0.04
225 0.03
226 0.03
227 0.03
228 0.03
229 0.04
230 0.05
231 0.07
232 0.07
233 0.08
234 0.17
235 0.23
236 0.28
237 0.34
238 0.36
239 0.4
240 0.43
241 0.43
242 0.39
243 0.33
244 0.31
245 0.26
246 0.28
247 0.25
248 0.27
249 0.27
250 0.25
251 0.27
252 0.24
253 0.23
254 0.18
255 0.16
256 0.11
257 0.1
258 0.09
259 0.08
260 0.08
261 0.08
262 0.07
263 0.07
264 0.08
265 0.08
266 0.09
267 0.1
268 0.12
269 0.14
270 0.17
271 0.24
272 0.27
273 0.29
274 0.3
275 0.28
276 0.26
277 0.28
278 0.28
279 0.23
280 0.27
281 0.31
282 0.33
283 0.32
284 0.36
285 0.34
286 0.39
287 0.43
288 0.42
289 0.45
290 0.46
291 0.52
292 0.56
293 0.56
294 0.5
295 0.46
296 0.45
297 0.38
298 0.37
299 0.34
300 0.33
301 0.35
302 0.34
303 0.32
304 0.27
305 0.25
306 0.23