Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2H7W3

Protein Details
Accession A0A1X2H7W3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-37TKTHTLCRRCGRRSLHKQKKTCASCHydrophilic
NLS Segment(s)
PositionSequence
54-56KRR
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTTSFGKRQTKTHTLCRRCGRRSLHKQKKTCASCGYPSAKIRKYNWSEKAKRRKTTGTGRMSYLKQVHRRFLNGFRENTQAQKQKKAETSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.69
3 0.7
4 0.67
5 0.74
6 0.78
7 0.79
8 0.73
9 0.75
10 0.73
11 0.74
12 0.79
13 0.81
14 0.82
15 0.81
16 0.83
17 0.82
18 0.84
19 0.77
20 0.7
21 0.65
22 0.58
23 0.52
24 0.53
25 0.49
26 0.43
27 0.43
28 0.45
29 0.44
30 0.45
31 0.44
32 0.46
33 0.48
34 0.52
35 0.57
36 0.6
37 0.64
38 0.68
39 0.77
40 0.77
41 0.76
42 0.73
43 0.7
44 0.68
45 0.7
46 0.7
47 0.67
48 0.61
49 0.59
50 0.58
51 0.52
52 0.5
53 0.46
54 0.44
55 0.45
56 0.47
57 0.51
58 0.5
59 0.53
60 0.52
61 0.55
62 0.58
63 0.55
64 0.54
65 0.5
66 0.52
67 0.49
68 0.5
69 0.5
70 0.48
71 0.46
72 0.53
73 0.54
74 0.57