Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2H227

Protein Details
Accession A0A1X2H227   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
145-173RSSHRHVTTKKTYKLPRLNQKLRKGDPYTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011516  Shugoshin_N  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF07558  Shugoshin_N  
Amino Acid Sequences MRSEPSRVSRHGQQNEELARTNAFLLMHNRRLENDILELKAENLSLREQLLLCRRQHGQQRGPQCEPEPEPEPESEAEPESEAEPEGGGTPTPVHDRPHEACPNIGNAKMSLFEPSTSPTLSPEKIPAQTSETTETATAHSVQTRSSHRHVTTKKTYKLPRLNQKLRKGDPYTFGNTPKRKQKRID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.56
4 0.49
5 0.39
6 0.32
7 0.28
8 0.25
9 0.19
10 0.15
11 0.15
12 0.21
13 0.27
14 0.33
15 0.34
16 0.35
17 0.34
18 0.37
19 0.35
20 0.3
21 0.27
22 0.24
23 0.22
24 0.22
25 0.21
26 0.18
27 0.17
28 0.15
29 0.1
30 0.09
31 0.1
32 0.1
33 0.1
34 0.11
35 0.1
36 0.15
37 0.22
38 0.27
39 0.26
40 0.29
41 0.31
42 0.35
43 0.44
44 0.49
45 0.49
46 0.49
47 0.57
48 0.61
49 0.61
50 0.58
51 0.5
52 0.46
53 0.4
54 0.39
55 0.34
56 0.29
57 0.28
58 0.26
59 0.26
60 0.21
61 0.21
62 0.17
63 0.13
64 0.11
65 0.1
66 0.1
67 0.09
68 0.09
69 0.07
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.05
79 0.08
80 0.1
81 0.11
82 0.12
83 0.17
84 0.2
85 0.27
86 0.3
87 0.27
88 0.27
89 0.26
90 0.29
91 0.25
92 0.23
93 0.16
94 0.13
95 0.13
96 0.13
97 0.12
98 0.1
99 0.09
100 0.09
101 0.09
102 0.11
103 0.12
104 0.12
105 0.12
106 0.13
107 0.16
108 0.16
109 0.16
110 0.18
111 0.2
112 0.22
113 0.24
114 0.22
115 0.23
116 0.24
117 0.26
118 0.26
119 0.22
120 0.21
121 0.2
122 0.19
123 0.16
124 0.15
125 0.14
126 0.11
127 0.13
128 0.13
129 0.13
130 0.18
131 0.22
132 0.27
133 0.3
134 0.37
135 0.37
136 0.47
137 0.51
138 0.55
139 0.61
140 0.65
141 0.68
142 0.7
143 0.75
144 0.76
145 0.81
146 0.82
147 0.82
148 0.83
149 0.87
150 0.87
151 0.89
152 0.89
153 0.84
154 0.83
155 0.78
156 0.72
157 0.68
158 0.64
159 0.6
160 0.55
161 0.57
162 0.58
163 0.6
164 0.63
165 0.68
166 0.72