Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2H0P6

Protein Details
Accession A0A1X2H0P6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
102-124AIGICVRIQNNKKREREKKRERRBasic
NLS Segment(s)
PositionSequence
113-124KKREREKKRERR
Subcellular Location(s) plas 7, cyto 5, cyto_nucl 5, E.R. 4, nucl 3, mito 3, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MECSAKEVFLVWDFVVFTSVRTNQSCTYPHCVHPGICFWIITVLDELFQAAQEHMGSYDHIQQCIGRLSDPFYAISNALVHDFCTLQSRFQLFLYTLATLLAIGICVRIQNNKKREREKKRERR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.11
4 0.1
5 0.13
6 0.16
7 0.19
8 0.21
9 0.24
10 0.24
11 0.29
12 0.32
13 0.31
14 0.37
15 0.36
16 0.37
17 0.39
18 0.39
19 0.35
20 0.34
21 0.33
22 0.29
23 0.26
24 0.23
25 0.18
26 0.18
27 0.17
28 0.16
29 0.13
30 0.09
31 0.08
32 0.08
33 0.08
34 0.05
35 0.06
36 0.05
37 0.04
38 0.05
39 0.04
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.14
46 0.14
47 0.14
48 0.14
49 0.13
50 0.15
51 0.16
52 0.15
53 0.09
54 0.08
55 0.11
56 0.13
57 0.14
58 0.13
59 0.11
60 0.12
61 0.12
62 0.12
63 0.09
64 0.08
65 0.09
66 0.08
67 0.08
68 0.08
69 0.08
70 0.07
71 0.12
72 0.12
73 0.12
74 0.16
75 0.17
76 0.18
77 0.18
78 0.2
79 0.15
80 0.17
81 0.18
82 0.14
83 0.13
84 0.11
85 0.11
86 0.08
87 0.08
88 0.06
89 0.04
90 0.04
91 0.04
92 0.04
93 0.05
94 0.07
95 0.16
96 0.24
97 0.33
98 0.43
99 0.52
100 0.62
101 0.72
102 0.82
103 0.85
104 0.88