Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2H2I1

Protein Details
Accession A0A1X2H2I1    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-45LERNRQAALKCRQRKKQWLNDLQAKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000837  AP-1  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences KRRTRCPKFFDDDEKRRNFLERNRQAALKCRQRKKQWLNDLQAKADFLTADNEQLQMHICALREEVVNLRTLLYAHRDCSVTRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.69
3 0.62
4 0.59
5 0.54
6 0.53
7 0.54
8 0.53
9 0.55
10 0.55
11 0.57
12 0.54
13 0.57
14 0.57
15 0.56
16 0.57
17 0.59
18 0.66
19 0.72
20 0.81
21 0.82
22 0.83
23 0.83
24 0.82
25 0.81
26 0.8
27 0.73
28 0.63
29 0.54
30 0.44
31 0.33
32 0.24
33 0.17
34 0.08
35 0.1
36 0.08
37 0.09
38 0.09
39 0.1
40 0.09
41 0.09
42 0.1
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.11
50 0.1
51 0.11
52 0.14
53 0.13
54 0.15
55 0.14
56 0.14
57 0.13
58 0.13
59 0.14
60 0.18
61 0.2
62 0.2
63 0.23
64 0.23