Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2H8T9

Protein Details
Accession A0A1X2H8T9    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-79KTSKSANKTVCEKKKKRKKTSPSVTRTSHTHydrophilic
NLS Segment(s)
PositionSequence
47-58KRFKTSKSANKT
60-68CEKKKKRKK
Subcellular Location(s) plas 11, E.R. 5, nucl 2, mito 2, extr 2, pero 2, golg 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MFVMFVGLIVFLCQIQNQGVPAPWVGVVRRGSFNTLIHFCTDLRKFKRFKTSKSANKTVCEKKKKRKKTSPSVTRTSHTSLCGFCHPRTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.09
5 0.1
6 0.11
7 0.11
8 0.11
9 0.11
10 0.1
11 0.11
12 0.1
13 0.14
14 0.16
15 0.18
16 0.2
17 0.2
18 0.22
19 0.23
20 0.24
21 0.22
22 0.22
23 0.2
24 0.18
25 0.19
26 0.16
27 0.2
28 0.23
29 0.26
30 0.29
31 0.34
32 0.36
33 0.39
34 0.51
35 0.49
36 0.51
37 0.53
38 0.59
39 0.62
40 0.69
41 0.73
42 0.66
43 0.66
44 0.69
45 0.69
46 0.69
47 0.7
48 0.71
49 0.74
50 0.81
51 0.87
52 0.9
53 0.91
54 0.92
55 0.92
56 0.94
57 0.94
58 0.91
59 0.88
60 0.81
61 0.73
62 0.67
63 0.61
64 0.53
65 0.45
66 0.4
67 0.33
68 0.32
69 0.39
70 0.38