Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GYU7

Protein Details
Accession A0A1X2GYU7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-41APCITLRTRKIKTNRPPRHTSKQCCRSDAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MCLSMRLYPSAPAPCITLRTRKIKTNRPPRHTSKQCCRSDAPLLVRLSIAIRMPYNVNLEKRRNYHAEILIPVFAITSRYKLLYAKWPIPRARFASPIQIRTRTAVEFFEAVRMQTREYSVLVIFSII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.3
4 0.34
5 0.36
6 0.45
7 0.48
8 0.54
9 0.61
10 0.67
11 0.74
12 0.76
13 0.8
14 0.78
15 0.83
16 0.83
17 0.86
18 0.85
19 0.85
20 0.84
21 0.84
22 0.81
23 0.77
24 0.71
25 0.64
26 0.61
27 0.57
28 0.5
29 0.46
30 0.42
31 0.37
32 0.34
33 0.29
34 0.23
35 0.18
36 0.14
37 0.09
38 0.08
39 0.09
40 0.1
41 0.12
42 0.15
43 0.17
44 0.21
45 0.26
46 0.3
47 0.33
48 0.35
49 0.37
50 0.36
51 0.36
52 0.36
53 0.33
54 0.31
55 0.27
56 0.25
57 0.21
58 0.18
59 0.15
60 0.1
61 0.07
62 0.08
63 0.07
64 0.08
65 0.09
66 0.09
67 0.1
68 0.11
69 0.14
70 0.2
71 0.26
72 0.31
73 0.37
74 0.43
75 0.47
76 0.49
77 0.53
78 0.48
79 0.47
80 0.44
81 0.4
82 0.44
83 0.44
84 0.48
85 0.47
86 0.46
87 0.44
88 0.42
89 0.43
90 0.34
91 0.3
92 0.25
93 0.22
94 0.19
95 0.18
96 0.21
97 0.18
98 0.17
99 0.21
100 0.21
101 0.2
102 0.21
103 0.23
104 0.2
105 0.2
106 0.22
107 0.17
108 0.17