Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HHY8

Protein Details
Accession A0A1X2HHY8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-98CGTRTRTAFLKKKERKTIQETAVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, golg 3, mito 1, plas 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MCLYTKNAWLSDLAVALFAAAIIAIQVAASATKVLATVSQNINNVFVTDILVLLDSINSYSWGEEHSAQKVCQLVCGTRTRTAFLKKKERKTIQETAVETSSWPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.07
5 0.05
6 0.04
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.04
22 0.06
23 0.07
24 0.11
25 0.14
26 0.17
27 0.18
28 0.18
29 0.19
30 0.17
31 0.16
32 0.12
33 0.09
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.07
51 0.1
52 0.11
53 0.15
54 0.17
55 0.17
56 0.19
57 0.21
58 0.19
59 0.2
60 0.2
61 0.17
62 0.2
63 0.26
64 0.28
65 0.3
66 0.31
67 0.3
68 0.34
69 0.43
70 0.47
71 0.5
72 0.58
73 0.62
74 0.72
75 0.8
76 0.83
77 0.82
78 0.82
79 0.83
80 0.79
81 0.77
82 0.69
83 0.63
84 0.55
85 0.47