Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2GYZ9

Protein Details
Accession A0A1X2GYZ9   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-52ASAKRRSQVRTRKIKTNRPPRHTSKQCCRSDAHydrophilic
NLS Segment(s)
PositionSequence
25-39RRSQVRTRKIKTNRP
Subcellular Location(s) mito 10, cyto_nucl 9.5, nucl 8.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MRKQHKEVGVRSNDEPIAELASAKRRSQVRTRKIKTNRPPRHTSKQCCRSDAPLLVRLRVNAFTLPIGAIRLPVVRGCHDAVHASRAPPPGPEITSTINITETRIASRLAGNYTANHLASIAIRMPYNVNLEKRRNYHAEILIPVFAITSRYKLLYAKWPIPESKICKVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.27
4 0.21
5 0.17
6 0.16
7 0.14
8 0.22
9 0.25
10 0.24
11 0.29
12 0.31
13 0.37
14 0.47
15 0.55
16 0.57
17 0.65
18 0.7
19 0.75
20 0.8
21 0.85
22 0.85
23 0.86
24 0.86
25 0.83
26 0.86
27 0.84
28 0.86
29 0.85
30 0.85
31 0.84
32 0.84
33 0.81
34 0.77
35 0.71
36 0.64
37 0.61
38 0.57
39 0.5
40 0.47
41 0.43
42 0.4
43 0.38
44 0.34
45 0.29
46 0.23
47 0.2
48 0.13
49 0.13
50 0.11
51 0.11
52 0.1
53 0.08
54 0.08
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.07
61 0.08
62 0.09
63 0.11
64 0.12
65 0.12
66 0.12
67 0.13
68 0.13
69 0.15
70 0.15
71 0.13
72 0.16
73 0.17
74 0.17
75 0.15
76 0.16
77 0.14
78 0.14
79 0.15
80 0.14
81 0.15
82 0.17
83 0.17
84 0.15
85 0.15
86 0.14
87 0.14
88 0.13
89 0.11
90 0.1
91 0.11
92 0.11
93 0.1
94 0.12
95 0.13
96 0.12
97 0.14
98 0.13
99 0.13
100 0.16
101 0.17
102 0.16
103 0.14
104 0.13
105 0.11
106 0.11
107 0.12
108 0.1
109 0.09
110 0.09
111 0.09
112 0.11
113 0.13
114 0.18
115 0.21
116 0.26
117 0.32
118 0.38
119 0.44
120 0.47
121 0.5
122 0.49
123 0.49
124 0.5
125 0.47
126 0.45
127 0.41
128 0.4
129 0.34
130 0.29
131 0.25
132 0.18
133 0.13
134 0.12
135 0.1
136 0.11
137 0.13
138 0.14
139 0.15
140 0.17
141 0.21
142 0.27
143 0.34
144 0.38
145 0.43
146 0.46
147 0.47
148 0.51
149 0.56
150 0.53