FuNGI

A0A1X2H7B6

Protein Details

Accession

A0A1X2H7B6

Localization Confidence

High

Confidence Score

15.6

NoLS Segment(s)

Position	Sequence	Protein Nature
115-134	VYERYQRSQKPQRRDSYEDY	Hydrophilic
577-619	LDEHKQREWERARRPQPSGPNKKNRKRKHKQQHHYKQPILQVS	Basic

NLS Segment(s)

Position	Sequence
584-606	EWERARRPQPSGPNKKNRKRKHK

Subcellular Location(s)

nucl 20.5, cyto_nucl 12.5, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036533 BAG_dom_sf IPR003103 BAG_domain
Gene Ontology	GO:0051087 F:protein-folding chaperone binding
Pfam	View protein in Pfam PF02179 BAG
PROSITE	View protein in PROSITE PS51035 BAG

Amino Acid Sequences

MLFYNSPHHLVVHRPETYNLQRSMTLDDYLQLQLLLQHEQEQRKQRDAWQQEQLRLQHAMANLKALKENYRRQRAMQIQQCIERYREQEARIQAQEDFYRQCLAAAIEQRRAEEVYERYQRSQKPQRRDSYEDYREQQLASVLKLLFNQTDNEDDNDEVMQDTQAKNEEEDQEVQTLWDYITREQSHEQEDEEMQDSNEEEDEEEQEEESESEQQEETSRSPPRLAALPSSSDHHPEAYTPLFSRNDARSKEAVPVRQQASATPPLQNHVLNLKDLLDQLVSHDEEPQQQQHQAGFGKPQPIFDANESGAQDSATAQQPPPNTMTNLARELKSQSLGSTQEQEKQQKREQPSQPPKQFSKDAPQSKHNTRIFDADEPAAQPSAITQPPPANTTAHMHKEASQPQSTKPLFDLDEAAAARSSTAQPPPEHTTQNVLGDQADDNLYAPQDIRTEAEPTPLKEKTPAFPQQEQGQAQRQEKPSSRLPGTVSIKLDGISKELKSIRSREDEVLQAPLDFKEKNDTLILPATTPNNRHFLGYEDEIMRVMLKLDTIESDGDEGIRNARRALVKEAEGMLERLDEHKQREWERARRPQPSGPNKKNRKRKHKQQHHYKQPILQVS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.39
2	0.41
3	0.48
4	0.55
5	0.56
6	0.5
7	0.45
8	0.43
9	0.42
10	0.46
11	0.4
12	0.32
13	0.24
14	0.23
15	0.23
16	0.21
17	0.2
18	0.13
19	0.11
20	0.12
21	0.14
22	0.15
23	0.13
24	0.2
25	0.26
26	0.32
27	0.4
28	0.47
29	0.51
30	0.54
31	0.57
32	0.57
33	0.62
34	0.64
35	0.64
36	0.64
37	0.65
38	0.65
39	0.69
40	0.63
41	0.56
42	0.5
43	0.43
44	0.36
45	0.34
46	0.33
47	0.27
48	0.31
49	0.29
50	0.28
51	0.31
52	0.29
53	0.35
54	0.38
55	0.47
56	0.51
57	0.6
58	0.61
59	0.61
60	0.7
61	0.7
62	0.72
63	0.7
64	0.69
65	0.63
66	0.66
67	0.67
68	0.6
69	0.53
70	0.48
71	0.43
72	0.41
73	0.42
74	0.38
75	0.41
76	0.44
77	0.48
78	0.45
79	0.43
80	0.37
81	0.35
82	0.36
83	0.33
84	0.29
85	0.23
86	0.23
87	0.21
88	0.21
89	0.18
90	0.17
91	0.19
92	0.24
93	0.27
94	0.31
95	0.32
96	0.32
97	0.32
98	0.31
99	0.27
100	0.25
101	0.25
102	0.28
103	0.36
104	0.38
105	0.41
106	0.47
107	0.51
108	0.56
109	0.63
110	0.62
111	0.65
112	0.72
113	0.77
114	0.78
115	0.81
116	0.78
117	0.78
118	0.77
119	0.73
120	0.67
121	0.61
122	0.54
123	0.46
124	0.39
125	0.32
126	0.26
127	0.2
128	0.21
129	0.17
130	0.17
131	0.18
132	0.19
133	0.16
134	0.16
135	0.17
136	0.14
137	0.17
138	0.18
139	0.19
140	0.19
141	0.17
142	0.16
143	0.15
144	0.13
145	0.1
146	0.09
147	0.08
148	0.09
149	0.09
150	0.1
151	0.14
152	0.14
153	0.15
154	0.18
155	0.2
156	0.2
157	0.22
158	0.22
159	0.19
160	0.18
161	0.18
162	0.14
163	0.12
164	0.09
165	0.1
166	0.1
167	0.1
168	0.18
169	0.19
170	0.22
171	0.24
172	0.27
173	0.28
174	0.27
175	0.26
176	0.21
177	0.2
178	0.2
179	0.18
180	0.16
181	0.12
182	0.12
183	0.11
184	0.09
185	0.09
186	0.07
187	0.06
188	0.06
189	0.08
190	0.08
191	0.08
192	0.08
193	0.08
194	0.08
195	0.08
196	0.08
197	0.09
198	0.08
199	0.09
200	0.09
201	0.09
202	0.11
203	0.12
204	0.14
205	0.17
206	0.19
207	0.19
208	0.2
209	0.2
210	0.2
211	0.23
212	0.22
213	0.2
214	0.2
215	0.21
216	0.22
217	0.24
218	0.23
219	0.21
220	0.21
221	0.18
222	0.16
223	0.14
224	0.16
225	0.14
226	0.15
227	0.13
228	0.17
229	0.16
230	0.17
231	0.21
232	0.23
233	0.29
234	0.29
235	0.33
236	0.3
237	0.3
238	0.37
239	0.36
240	0.35
241	0.32
242	0.37
243	0.34
244	0.35
245	0.34
246	0.28
247	0.29
248	0.3
249	0.27
250	0.23
251	0.22
252	0.21
253	0.23
254	0.22
255	0.18
256	0.17
257	0.17
258	0.14
259	0.15
260	0.14
261	0.13
262	0.13
263	0.12
264	0.08
265	0.07
266	0.08
267	0.1
268	0.09
269	0.09
270	0.1
271	0.1
272	0.13
273	0.14
274	0.16
275	0.14
276	0.15
277	0.16
278	0.15
279	0.17
280	0.16
281	0.15
282	0.16
283	0.16
284	0.21
285	0.2
286	0.2
287	0.19
288	0.2
289	0.21
290	0.18
291	0.19
292	0.14
293	0.17
294	0.16
295	0.14
296	0.13
297	0.11
298	0.1
299	0.07
300	0.09
301	0.08
302	0.09
303	0.08
304	0.11
305	0.12
306	0.13
307	0.15
308	0.14
309	0.14
310	0.16
311	0.18
312	0.19
313	0.23
314	0.23
315	0.21
316	0.2
317	0.22
318	0.2
319	0.19
320	0.16
321	0.12
322	0.13
323	0.15
324	0.15
325	0.18
326	0.18
327	0.22
328	0.26
329	0.34
330	0.37
331	0.41
332	0.45
333	0.46
334	0.51
335	0.56
336	0.58
337	0.62
338	0.67
339	0.72
340	0.73
341	0.73
342	0.69
343	0.65
344	0.62
345	0.53
346	0.53
347	0.52
348	0.53
349	0.51
350	0.55
351	0.57
352	0.58
353	0.65
354	0.58
355	0.51
356	0.44
357	0.45
358	0.4
359	0.36
360	0.33
361	0.24
362	0.21
363	0.19
364	0.18
365	0.14
366	0.11
367	0.08
368	0.07
369	0.1
370	0.1
371	0.1
372	0.11
373	0.14
374	0.16
375	0.17
376	0.18
377	0.14
378	0.15
379	0.19
380	0.23
381	0.25
382	0.25
383	0.25
384	0.27
385	0.33
386	0.37
387	0.37
388	0.36
389	0.34
390	0.33
391	0.42
392	0.39
393	0.34
394	0.29
395	0.27
396	0.24
397	0.23
398	0.24
399	0.14
400	0.18
401	0.17
402	0.16
403	0.13
404	0.11
405	0.11
406	0.1
407	0.11
408	0.1
409	0.13
410	0.17
411	0.18
412	0.23
413	0.29
414	0.32
415	0.32
416	0.3
417	0.32
418	0.31
419	0.33
420	0.28
421	0.23
422	0.19
423	0.18
424	0.18
425	0.13
426	0.11
427	0.08
428	0.08
429	0.08
430	0.08
431	0.07
432	0.07
433	0.07
434	0.08
435	0.09
436	0.1
437	0.11
438	0.14
439	0.14
440	0.21
441	0.22
442	0.24
443	0.29
444	0.28
445	0.27
446	0.29
447	0.32
448	0.28
449	0.34
450	0.41
451	0.42
452	0.44
453	0.48
454	0.47
455	0.52
456	0.51
457	0.47
458	0.46
459	0.47
460	0.46
461	0.5
462	0.49
463	0.49
464	0.51
465	0.52
466	0.51
467	0.52
468	0.51
469	0.47
470	0.45
471	0.48
472	0.48
473	0.48
474	0.42
475	0.35
476	0.34
477	0.31
478	0.31
479	0.22
480	0.2
481	0.18
482	0.17
483	0.21
484	0.24
485	0.29
486	0.31
487	0.35
488	0.38
489	0.42
490	0.45
491	0.43
492	0.44
493	0.42
494	0.38
495	0.37
496	0.31
497	0.24
498	0.22
499	0.19
500	0.19
501	0.15
502	0.14
503	0.19
504	0.2
505	0.22
506	0.23
507	0.22
508	0.22
509	0.27
510	0.26
511	0.19
512	0.21
513	0.23
514	0.25
515	0.28
516	0.29
517	0.29
518	0.29
519	0.3
520	0.28
521	0.27
522	0.29
523	0.28
524	0.3
525	0.25
526	0.25
527	0.24
528	0.23
529	0.2
530	0.14
531	0.12
532	0.08
533	0.07
534	0.08
535	0.08
536	0.09
537	0.11
538	0.11
539	0.1
540	0.11
541	0.11
542	0.11
543	0.11
544	0.1
545	0.15
546	0.19
547	0.19
548	0.19
549	0.24
550	0.28
551	0.3
552	0.37
553	0.37
554	0.34
555	0.37
556	0.37
557	0.34
558	0.31
559	0.28
560	0.22
561	0.17
562	0.16
563	0.14
564	0.19
565	0.22
566	0.25
567	0.32
568	0.4
569	0.42
570	0.52
571	0.59
572	0.63
573	0.69
574	0.75
575	0.77
576	0.78
577	0.81
578	0.8
579	0.81
580	0.82
581	0.83
582	0.83
583	0.85
584	0.88
585	0.92
586	0.94
587	0.94
588	0.94
589	0.94
590	0.95
591	0.95
592	0.95
593	0.96
594	0.97
595	0.97
596	0.97
597	0.96
598	0.92
599	0.87

A0A1X2H7B6

3D AlphaFold-predicted Structure Viewer