Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HS18

Protein Details
Accession A0A1X2HS18   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-37PLPMRSPRRRTTRSLRRTRRKTTSPPSQLHydrophilic
NLS Segment(s)
PositionSequence
12-29MRSPRRRTTRSLRRTRRK
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MSLLPLPRPLPMRSPRRRTTRSLRRTRRKTTSPPSQLLRPLLPTLLPHLLPSRPLPKCYNNGIQNAYARRHTPLDIFLLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.75
4 0.78
5 0.77
6 0.79
7 0.79
8 0.8
9 0.82
10 0.84
11 0.85
12 0.89
13 0.91
14 0.89
15 0.86
16 0.85
17 0.83
18 0.83
19 0.79
20 0.74
21 0.68
22 0.62
23 0.57
24 0.5
25 0.41
26 0.32
27 0.25
28 0.2
29 0.17
30 0.14
31 0.14
32 0.13
33 0.12
34 0.11
35 0.13
36 0.13
37 0.15
38 0.18
39 0.24
40 0.24
41 0.28
42 0.32
43 0.36
44 0.41
45 0.46
46 0.51
47 0.47
48 0.5
49 0.49
50 0.47
51 0.48
52 0.48
53 0.44
54 0.39
55 0.35
56 0.34
57 0.34
58 0.32
59 0.29
60 0.28