Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HWJ8

Protein Details
Accession A0A1X2HWJ8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
100-124NDSIKLAKGSHRKNRKKVAAGCCGGHydrophilic
NLS Segment(s)
PositionSequence
108-116GSHRKNRKK
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045298  Complex1_LYR_LYRM7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20267  Complex1_LYR_LYRM7  
Amino Acid Sequences MSAVPLTPSRQAVLSAYRMLLRTQREVFGEDLRTIQAARKETRARFMQNKDESNVDVIEEKLKTADQIASLLRRNVVQGVSEGEGTFKLRITKDTELGDNDSIKLAKGSHRKNRKKVAAGCCGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.21
4 0.22
5 0.22
6 0.22
7 0.25
8 0.24
9 0.27
10 0.27
11 0.29
12 0.29
13 0.3
14 0.3
15 0.29
16 0.27
17 0.22
18 0.2
19 0.18
20 0.17
21 0.15
22 0.16
23 0.16
24 0.19
25 0.2
26 0.27
27 0.33
28 0.34
29 0.41
30 0.42
31 0.44
32 0.48
33 0.51
34 0.54
35 0.53
36 0.54
37 0.49
38 0.45
39 0.39
40 0.32
41 0.27
42 0.17
43 0.12
44 0.1
45 0.1
46 0.09
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.08
53 0.06
54 0.07
55 0.09
56 0.11
57 0.13
58 0.13
59 0.13
60 0.12
61 0.12
62 0.12
63 0.12
64 0.09
65 0.09
66 0.1
67 0.11
68 0.11
69 0.1
70 0.09
71 0.09
72 0.1
73 0.1
74 0.09
75 0.12
76 0.12
77 0.15
78 0.21
79 0.24
80 0.26
81 0.28
82 0.3
83 0.28
84 0.31
85 0.31
86 0.25
87 0.22
88 0.2
89 0.18
90 0.16
91 0.14
92 0.12
93 0.18
94 0.27
95 0.36
96 0.45
97 0.56
98 0.67
99 0.76
100 0.85
101 0.87
102 0.88
103 0.87
104 0.87
105 0.86