Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0D130

Protein Details
Accession J0D130   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-72PASPRACRKLLNKKRKRDWPTLPEPESHydrophilic
NLS Segment(s)
PositionSequence
57-62NKKRKR
Subcellular Location(s) nucl 9.5, cyto_nucl 9, cyto 7.5, mito 7
Family & Domain DBs
KEGG adl:AURDEDRAFT_171827  -  
Amino Acid Sequences MFSAQVIQAISSLLQSPTPAPPPGLKSHAHDKPLELLPRCTTFSTPASPRACRKLLNKKRKRDWPTLPEPESPHADKRRNILGSGLPASPRKEDARRGLLFGISRIAARRVSPSVDVFGPEGSSTPKRAFAASRSGVAQFGLGLFSPTSACGTSPLMSLVLSPAKPTVADSPTRMVVVSPVLQTPALT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.12
4 0.15
5 0.19
6 0.19
7 0.2
8 0.23
9 0.28
10 0.32
11 0.35
12 0.33
13 0.34
14 0.43
15 0.46
16 0.46
17 0.42
18 0.39
19 0.41
20 0.45
21 0.47
22 0.39
23 0.37
24 0.37
25 0.39
26 0.39
27 0.34
28 0.29
29 0.26
30 0.27
31 0.3
32 0.29
33 0.34
34 0.37
35 0.4
36 0.43
37 0.46
38 0.45
39 0.44
40 0.51
41 0.54
42 0.61
43 0.68
44 0.72
45 0.76
46 0.83
47 0.88
48 0.86
49 0.85
50 0.84
51 0.82
52 0.83
53 0.81
54 0.75
55 0.68
56 0.63
57 0.56
58 0.51
59 0.44
60 0.41
61 0.4
62 0.41
63 0.4
64 0.41
65 0.45
66 0.41
67 0.39
68 0.34
69 0.28
70 0.25
71 0.25
72 0.22
73 0.16
74 0.17
75 0.18
76 0.17
77 0.18
78 0.18
79 0.19
80 0.24
81 0.28
82 0.34
83 0.33
84 0.33
85 0.31
86 0.29
87 0.26
88 0.21
89 0.17
90 0.09
91 0.09
92 0.09
93 0.1
94 0.09
95 0.09
96 0.12
97 0.12
98 0.14
99 0.15
100 0.15
101 0.16
102 0.15
103 0.15
104 0.13
105 0.12
106 0.1
107 0.09
108 0.08
109 0.1
110 0.11
111 0.13
112 0.13
113 0.16
114 0.17
115 0.18
116 0.2
117 0.19
118 0.27
119 0.26
120 0.27
121 0.25
122 0.24
123 0.23
124 0.21
125 0.18
126 0.09
127 0.08
128 0.07
129 0.05
130 0.06
131 0.05
132 0.06
133 0.06
134 0.07
135 0.08
136 0.08
137 0.08
138 0.09
139 0.12
140 0.12
141 0.12
142 0.13
143 0.12
144 0.11
145 0.11
146 0.12
147 0.14
148 0.13
149 0.13
150 0.13
151 0.13
152 0.14
153 0.16
154 0.19
155 0.19
156 0.23
157 0.24
158 0.28
159 0.29
160 0.29
161 0.27
162 0.21
163 0.19
164 0.19
165 0.19
166 0.17
167 0.16
168 0.17