Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HIH5

Protein Details
Accession A0A1X2HIH5    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21GKVHKRSLIKKPKSKNDIYVSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
IPR002775  DNA/RNA-bd_Alba-like  
IPR014612  Pop7/Rpp20  
Gene Ontology GO:0005655  C:nucleolar ribonuclease P complex  
GO:0000172  C:ribonuclease MRP complex  
GO:0003676  F:nucleic acid binding  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF01918  Alba  
Amino Acid Sequences GKVHKRSLIKKPKSKNDIYVSSKTRIEAVVKHICQLMIYENQRHMTVHGLGASMMRAITIAQRVQEKVHGHVDLRPTTDTITLIDDVVPEDMVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.78
4 0.77
5 0.74
6 0.72
7 0.66
8 0.61
9 0.56
10 0.47
11 0.4
12 0.33
13 0.28
14 0.22
15 0.26
16 0.31
17 0.3
18 0.3
19 0.3
20 0.28
21 0.25
22 0.23
23 0.19
24 0.16
25 0.18
26 0.19
27 0.2
28 0.22
29 0.22
30 0.21
31 0.19
32 0.15
33 0.13
34 0.11
35 0.1
36 0.09
37 0.09
38 0.09
39 0.08
40 0.05
41 0.04
42 0.04
43 0.03
44 0.03
45 0.05
46 0.07
47 0.08
48 0.1
49 0.12
50 0.13
51 0.14
52 0.2
53 0.2
54 0.22
55 0.26
56 0.25
57 0.24
58 0.26
59 0.31
60 0.28
61 0.29
62 0.26
63 0.22
64 0.22
65 0.23
66 0.2
67 0.15
68 0.16
69 0.14
70 0.13
71 0.13
72 0.12
73 0.11
74 0.12