Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HQJ6

Protein Details
Accession A0A1X2HQJ6   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-32NSSSNSRKSRDNNKKVVHNKSGDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000971  Globin  
IPR009050  Globin-like_sf  
IPR012292  Globin/Proto  
Gene Ontology GO:0020037  F:heme binding  
GO:0019825  F:oxygen binding  
Pfam View protein in Pfam  
PF00042  Globin  
PROSITE View protein in PROSITE  
PS01033  GLOBIN  
Amino Acid Sequences MLSGSSPENNSSSNSRKSRDNNKKVVHNKSGDDDGVTPPTQTELDLVRTSWERVSQIRRAEDDIAISPSHAFGLAFYDALFEANPELRTLFSNIFQQARALTGMISYIARAPALSADKQSNKRVPTIRELNQLRREGQAEEESADPEWLVDKLRELGARHYFYSVKPEQLAYVGPAFVTALQVRLGDEYEPRLGDAWLSAHAYAAHHMRVGLESQLAWQTSTASHQRRHKANCILQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.44
3 0.51
4 0.58
5 0.66
6 0.71
7 0.74
8 0.75
9 0.77
10 0.84
11 0.84
12 0.85
13 0.83
14 0.76
15 0.69
16 0.63
17 0.59
18 0.49
19 0.42
20 0.35
21 0.28
22 0.27
23 0.24
24 0.2
25 0.16
26 0.17
27 0.15
28 0.14
29 0.13
30 0.11
31 0.15
32 0.16
33 0.16
34 0.17
35 0.18
36 0.2
37 0.19
38 0.19
39 0.17
40 0.22
41 0.28
42 0.31
43 0.36
44 0.38
45 0.39
46 0.4
47 0.39
48 0.34
49 0.3
50 0.25
51 0.21
52 0.18
53 0.16
54 0.13
55 0.1
56 0.1
57 0.08
58 0.06
59 0.04
60 0.08
61 0.08
62 0.07
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.05
69 0.05
70 0.07
71 0.08
72 0.07
73 0.08
74 0.08
75 0.09
76 0.12
77 0.12
78 0.11
79 0.14
80 0.16
81 0.17
82 0.16
83 0.15
84 0.13
85 0.13
86 0.12
87 0.09
88 0.06
89 0.05
90 0.05
91 0.06
92 0.05
93 0.04
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.06
100 0.08
101 0.09
102 0.1
103 0.13
104 0.19
105 0.23
106 0.28
107 0.3
108 0.29
109 0.34
110 0.37
111 0.36
112 0.39
113 0.42
114 0.41
115 0.46
116 0.49
117 0.51
118 0.53
119 0.52
120 0.45
121 0.4
122 0.38
123 0.29
124 0.28
125 0.22
126 0.16
127 0.15
128 0.14
129 0.13
130 0.12
131 0.11
132 0.08
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.08
140 0.1
141 0.13
142 0.13
143 0.19
144 0.25
145 0.27
146 0.27
147 0.27
148 0.27
149 0.25
150 0.32
151 0.27
152 0.23
153 0.22
154 0.21
155 0.2
156 0.19
157 0.2
158 0.14
159 0.13
160 0.1
161 0.09
162 0.09
163 0.08
164 0.07
165 0.09
166 0.07
167 0.07
168 0.08
169 0.08
170 0.09
171 0.09
172 0.1
173 0.09
174 0.1
175 0.12
176 0.13
177 0.13
178 0.13
179 0.13
180 0.12
181 0.12
182 0.12
183 0.1
184 0.1
185 0.11
186 0.1
187 0.1
188 0.11
189 0.12
190 0.14
191 0.15
192 0.14
193 0.13
194 0.13
195 0.13
196 0.14
197 0.15
198 0.13
199 0.11
200 0.1
201 0.12
202 0.15
203 0.15
204 0.14
205 0.13
206 0.13
207 0.13
208 0.19
209 0.26
210 0.3
211 0.37
212 0.46
213 0.55
214 0.63
215 0.69
216 0.73