Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HPX1

Protein Details
Accession A0A1X2HPX1   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-39PAKTTEKKIKSGDKKRKVSRKETYSTHydrophilic
NLS Segment(s)
PositionSequence
10-34AGKAPAKTTEKKIKSGDKKRKVSRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKTDKPVAGKAPAKTTEKKIKSGDKKRKVSRKETYSTYIYRVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREVQTAVRLILPGELAKHAVSEGTKAVTKYTSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.52
4 0.56
5 0.58
6 0.56
7 0.59
8 0.59
9 0.64
10 0.69
11 0.75
12 0.78
13 0.77
14 0.84
15 0.87
16 0.9
17 0.88
18 0.87
19 0.86
20 0.83
21 0.78
22 0.73
23 0.69
24 0.64
25 0.57
26 0.5
27 0.47
28 0.4
29 0.36
30 0.35
31 0.33
32 0.31
33 0.35
34 0.34
35 0.29
36 0.29
37 0.28
38 0.25
39 0.25
40 0.23
41 0.18
42 0.15
43 0.12
44 0.12
45 0.12
46 0.11
47 0.09
48 0.09
49 0.09
50 0.09
51 0.1
52 0.08
53 0.09
54 0.09
55 0.08
56 0.07
57 0.06
58 0.06
59 0.07
60 0.07
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.12
68 0.17
69 0.19
70 0.23
71 0.25
72 0.26
73 0.27
74 0.29
75 0.31
76 0.31
77 0.34
78 0.32
79 0.33
80 0.32
81 0.31
82 0.31
83 0.27
84 0.22
85 0.17
86 0.15
87 0.12
88 0.12
89 0.12
90 0.1
91 0.09
92 0.1
93 0.1
94 0.1
95 0.1
96 0.09
97 0.1
98 0.1
99 0.11
100 0.12
101 0.14
102 0.16
103 0.16
104 0.18
105 0.18