Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0WN21

Protein Details
Accession J0WN21   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
259-284IGQMETRPRRKQLKSCGRWKAKSSTCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 9.5, cyto_mito 6.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
KEGG adl:AURDEDRAFT_77134  -  
Amino Acid Sequences ITHKVLIPGRAILARIEWHSGDYLNILAVYAPTSKQENKNFWDKLLEAQKEANEDQAKVDVLLGDFNFVEDSLDRFPTKLNPIDAPSSFSNIRRAWGLHDGWRKTFPDKIEWTWRNKAHKSMSRIDRIYVTDQLLKASREWDITISSLNESDHSRVLAEIVHARAPETGPGRWTMDARLCKDDEFMDRAEKIAAQHVEDMRKVNPDTRNEEHNVQRIWARAKLEITTIAKKRQRELRSALKSKVNTKMKEREEIKECLIGQMETRPRRKQLKSCGRWKAKSSTCKATGPEKLSRTETIRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.22
4 0.19
5 0.19
6 0.19
7 0.19
8 0.17
9 0.15
10 0.13
11 0.1
12 0.09
13 0.08
14 0.07
15 0.07
16 0.08
17 0.08
18 0.08
19 0.1
20 0.15
21 0.22
22 0.3
23 0.38
24 0.44
25 0.48
26 0.57
27 0.56
28 0.53
29 0.51
30 0.44
31 0.44
32 0.46
33 0.42
34 0.35
35 0.36
36 0.36
37 0.36
38 0.35
39 0.34
40 0.26
41 0.25
42 0.24
43 0.23
44 0.22
45 0.18
46 0.18
47 0.12
48 0.1
49 0.12
50 0.1
51 0.1
52 0.09
53 0.09
54 0.09
55 0.08
56 0.08
57 0.07
58 0.09
59 0.1
60 0.12
61 0.12
62 0.12
63 0.14
64 0.18
65 0.22
66 0.24
67 0.25
68 0.25
69 0.28
70 0.32
71 0.31
72 0.31
73 0.27
74 0.27
75 0.26
76 0.25
77 0.29
78 0.25
79 0.26
80 0.23
81 0.23
82 0.22
83 0.27
84 0.27
85 0.28
86 0.35
87 0.36
88 0.37
89 0.39
90 0.37
91 0.33
92 0.35
93 0.29
94 0.29
95 0.31
96 0.34
97 0.41
98 0.44
99 0.49
100 0.53
101 0.57
102 0.57
103 0.55
104 0.57
105 0.55
106 0.57
107 0.57
108 0.58
109 0.59
110 0.59
111 0.57
112 0.51
113 0.45
114 0.41
115 0.37
116 0.31
117 0.25
118 0.2
119 0.2
120 0.2
121 0.19
122 0.17
123 0.15
124 0.14
125 0.13
126 0.11
127 0.11
128 0.11
129 0.1
130 0.09
131 0.1
132 0.09
133 0.09
134 0.08
135 0.08
136 0.08
137 0.09
138 0.09
139 0.09
140 0.09
141 0.08
142 0.07
143 0.08
144 0.07
145 0.07
146 0.08
147 0.08
148 0.09
149 0.09
150 0.09
151 0.1
152 0.09
153 0.12
154 0.12
155 0.12
156 0.12
157 0.14
158 0.15
159 0.15
160 0.16
161 0.14
162 0.19
163 0.23
164 0.25
165 0.27
166 0.26
167 0.25
168 0.26
169 0.25
170 0.21
171 0.19
172 0.17
173 0.16
174 0.16
175 0.16
176 0.15
177 0.14
178 0.12
179 0.16
180 0.15
181 0.13
182 0.17
183 0.19
184 0.21
185 0.21
186 0.23
187 0.18
188 0.22
189 0.22
190 0.24
191 0.27
192 0.3
193 0.37
194 0.38
195 0.42
196 0.42
197 0.47
198 0.45
199 0.46
200 0.41
201 0.35
202 0.34
203 0.33
204 0.32
205 0.31
206 0.28
207 0.24
208 0.25
209 0.25
210 0.24
211 0.26
212 0.27
213 0.31
214 0.33
215 0.4
216 0.42
217 0.44
218 0.5
219 0.53
220 0.54
221 0.53
222 0.57
223 0.59
224 0.65
225 0.69
226 0.67
227 0.65
228 0.64
229 0.63
230 0.66
231 0.63
232 0.58
233 0.6
234 0.65
235 0.62
236 0.67
237 0.65
238 0.63
239 0.6
240 0.59
241 0.53
242 0.49
243 0.45
244 0.37
245 0.35
246 0.27
247 0.23
248 0.27
249 0.33
250 0.36
251 0.43
252 0.46
253 0.53
254 0.63
255 0.7
256 0.72
257 0.74
258 0.77
259 0.8
260 0.85
261 0.88
262 0.88
263 0.86
264 0.82
265 0.81
266 0.79
267 0.8
268 0.77
269 0.76
270 0.71
271 0.69
272 0.67
273 0.65
274 0.64
275 0.6
276 0.61
277 0.55
278 0.54
279 0.54
280 0.55
281 0.52