Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LBW6

Protein Details
Accession E2LBW6   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-86LLKRAKKYRARARSRISSKKFHydrophilic
NLS Segment(s)
PositionSequence
68-84KRAKKYRARARSRISSK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019460  Atg11_C  
KEGG mpr:MPER_03668  -  
Pfam View protein in Pfam  
PF10377  ATG11  
Amino Acid Sequences MARITSITEHIAHKDSLPSNDIYTSDLPDGAKYHLVDVELEWSTPSPQCHQSYEAILNKEWTVRELLKRAKKYRARARSRISSKKFAVGDLALFLPRNGNRAWAPFNAFDTLRADPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.26
4 0.27
5 0.25
6 0.24
7 0.24
8 0.24
9 0.21
10 0.18
11 0.18
12 0.16
13 0.16
14 0.14
15 0.14
16 0.15
17 0.13
18 0.15
19 0.13
20 0.14
21 0.13
22 0.13
23 0.13
24 0.11
25 0.14
26 0.11
27 0.1
28 0.1
29 0.09
30 0.1
31 0.11
32 0.12
33 0.12
34 0.18
35 0.2
36 0.22
37 0.24
38 0.24
39 0.25
40 0.29
41 0.29
42 0.25
43 0.23
44 0.22
45 0.2
46 0.2
47 0.17
48 0.12
49 0.11
50 0.12
51 0.15
52 0.2
53 0.28
54 0.34
55 0.42
56 0.46
57 0.53
58 0.58
59 0.65
60 0.7
61 0.73
62 0.74
63 0.76
64 0.79
65 0.8
66 0.82
67 0.83
68 0.78
69 0.76
70 0.69
71 0.67
72 0.59
73 0.49
74 0.43
75 0.33
76 0.27
77 0.2
78 0.19
79 0.13
80 0.12
81 0.12
82 0.14
83 0.14
84 0.16
85 0.15
86 0.18
87 0.2
88 0.24
89 0.28
90 0.26
91 0.3
92 0.3
93 0.32
94 0.32
95 0.3
96 0.27
97 0.27