Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HG26

Protein Details
Accession A0A1X2HG26    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
129-160AHERGRHRPARHWHKRKPDSSVKQLNRPKKENBasic
NLS Segment(s)
PositionSequence
130-158HERGRHRPARHWHKRKPDSSVKQLNRPKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039690  SNRNP25  
IPR040610  SNRNP25_ubiquitin  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0005689  C:U12-type spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF18036  Ubiquitin_4  
CDD cd17058  Ubl_SNRNP25  
Amino Acid Sequences MPNTSQLKLQLQELLEDDLLQDVPKNASLNDIELLIAAEEGRAFRIRVDRHPLPPVYIVVEQAATLRDIKKRIQDQVEQTLSTAKHISWKHIWTSYCLLFQGQRLLDDHAAVSRLGLHQDAVLKFSRIAHERGRHRPARHWHKRKPDSSVKQLNRPKKENTSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.2
3 0.18
4 0.16
5 0.13
6 0.12
7 0.1
8 0.1
9 0.08
10 0.09
11 0.12
12 0.13
13 0.11
14 0.15
15 0.15
16 0.16
17 0.15
18 0.14
19 0.12
20 0.11
21 0.11
22 0.07
23 0.07
24 0.05
25 0.04
26 0.04
27 0.04
28 0.06
29 0.07
30 0.07
31 0.09
32 0.16
33 0.19
34 0.25
35 0.34
36 0.37
37 0.4
38 0.45
39 0.44
40 0.39
41 0.38
42 0.32
43 0.27
44 0.23
45 0.19
46 0.14
47 0.13
48 0.11
49 0.1
50 0.1
51 0.07
52 0.08
53 0.09
54 0.12
55 0.14
56 0.16
57 0.23
58 0.26
59 0.31
60 0.34
61 0.37
62 0.39
63 0.45
64 0.44
65 0.37
66 0.33
67 0.31
68 0.27
69 0.22
70 0.19
71 0.1
72 0.16
73 0.16
74 0.2
75 0.21
76 0.23
77 0.25
78 0.29
79 0.29
80 0.26
81 0.3
82 0.27
83 0.24
84 0.22
85 0.2
86 0.16
87 0.17
88 0.19
89 0.15
90 0.14
91 0.14
92 0.17
93 0.16
94 0.16
95 0.15
96 0.1
97 0.11
98 0.1
99 0.08
100 0.07
101 0.07
102 0.08
103 0.08
104 0.07
105 0.08
106 0.13
107 0.13
108 0.14
109 0.15
110 0.15
111 0.15
112 0.17
113 0.22
114 0.2
115 0.23
116 0.3
117 0.37
118 0.45
119 0.54
120 0.61
121 0.63
122 0.64
123 0.69
124 0.72
125 0.75
126 0.78
127 0.79
128 0.8
129 0.84
130 0.9
131 0.87
132 0.86
133 0.85
134 0.84
135 0.84
136 0.85
137 0.8
138 0.8
139 0.84
140 0.84
141 0.83
142 0.79
143 0.77
144 0.76