Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2H3Q3

Protein Details
Accession A0A1X2H3Q3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRMRNPLKPKSKRRQFAELQEDTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044234  TMEM230  
IPR008590  TMEM_230/134  
Gene Ontology GO:0005776  C:autophagosome  
GO:0005769  C:early endosome  
GO:0005794  C:Golgi apparatus  
GO:0005770  C:late endosome  
GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF05915  TMEM_230_134  
Amino Acid Sequences MRMRNPLKPKSKRRQFAELQEDTGFTAEQFTAPEPQIPWKAIFLACLLFAAGSALIVVGALIKLGYITSEIWLSRGIPFLVLGCIMFIPGAYHLYLAYYAYYKYPGYDFSMIPDWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.84
3 0.84
4 0.83
5 0.74
6 0.66
7 0.57
8 0.51
9 0.41
10 0.33
11 0.22
12 0.12
13 0.11
14 0.07
15 0.07
16 0.08
17 0.08
18 0.11
19 0.11
20 0.13
21 0.13
22 0.17
23 0.2
24 0.2
25 0.2
26 0.18
27 0.19
28 0.17
29 0.17
30 0.13
31 0.11
32 0.09
33 0.08
34 0.08
35 0.05
36 0.05
37 0.04
38 0.03
39 0.03
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.04
55 0.04
56 0.06
57 0.06
58 0.07
59 0.07
60 0.08
61 0.08
62 0.09
63 0.09
64 0.08
65 0.08
66 0.08
67 0.08
68 0.07
69 0.06
70 0.05
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.05
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.08
83 0.07
84 0.08
85 0.07
86 0.08
87 0.09
88 0.12
89 0.11
90 0.12
91 0.13
92 0.15
93 0.2
94 0.23
95 0.22
96 0.24