Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HMQ8

Protein Details
Accession A0A1X2HMQ8    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MAKSKNHTNHNQNRKAHRNGIKKPKQHRYPSRKGVDAHydrophilic
NLS Segment(s)
PositionSequence
14-34RKAHRNGIKKPKQHRYPSRKG
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNRKAHRNGIKKPKQHRYPSRKGVDAKFLRNQRFALKGTQKALAAAKQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.78
5 0.77
6 0.78
7 0.81
8 0.8
9 0.79
10 0.82
11 0.83
12 0.83
13 0.83
14 0.84
15 0.83
16 0.84
17 0.86
18 0.81
19 0.76
20 0.72
21 0.64
22 0.63
23 0.58
24 0.53
25 0.51
26 0.54
27 0.52
28 0.49
29 0.48
30 0.42
31 0.42
32 0.39
33 0.41
34 0.42
35 0.44
36 0.43
37 0.46
38 0.41
39 0.4
40 0.41