Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HDC6

Protein Details
Accession A0A1X2HDC6    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
30-56PTSSSGGKKAKKKWSAKKVKDKANNMVHydrophilic
NLS Segment(s)
PositionSequence
36-50GKKAKKKWSAKKVKD
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MYVTAYWTHSKERNGPASVLPLSRPHHDVPTSSSGGKKAKKKWSAKKVKDKANNMVVLDKPTYERLFKEVPTYKLISQSVLVDRLRMNGSLARVAIKELEAQGLIKPLVRHRSQLIYTRATGDEKKAKGAESDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.5
3 0.46
4 0.46
5 0.43
6 0.36
7 0.29
8 0.28
9 0.28
10 0.3
11 0.32
12 0.28
13 0.32
14 0.32
15 0.32
16 0.31
17 0.34
18 0.34
19 0.31
20 0.3
21 0.29
22 0.35
23 0.4
24 0.42
25 0.45
26 0.52
27 0.61
28 0.7
29 0.76
30 0.8
31 0.85
32 0.87
33 0.9
34 0.88
35 0.89
36 0.87
37 0.82
38 0.79
39 0.74
40 0.66
41 0.56
42 0.5
43 0.4
44 0.34
45 0.28
46 0.2
47 0.15
48 0.15
49 0.16
50 0.14
51 0.14
52 0.15
53 0.17
54 0.17
55 0.23
56 0.25
57 0.26
58 0.28
59 0.3
60 0.27
61 0.29
62 0.29
63 0.22
64 0.18
65 0.19
66 0.17
67 0.19
68 0.18
69 0.14
70 0.14
71 0.16
72 0.16
73 0.14
74 0.14
75 0.12
76 0.13
77 0.14
78 0.14
79 0.13
80 0.12
81 0.12
82 0.12
83 0.1
84 0.1
85 0.09
86 0.1
87 0.09
88 0.09
89 0.09
90 0.11
91 0.11
92 0.12
93 0.13
94 0.18
95 0.26
96 0.27
97 0.29
98 0.3
99 0.38
100 0.4
101 0.46
102 0.46
103 0.43
104 0.42
105 0.43
106 0.41
107 0.38
108 0.36
109 0.35
110 0.38
111 0.35
112 0.4
113 0.38
114 0.37
115 0.36