Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2H3H9

Protein Details
Accession A0A1X2H3H9   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-95RLVNCNSSFWKKKKKKEKMKYLIPVDFRSHydrophilic
NLS Segment(s)
PositionSequence
77-85KKKKKKEKM
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYFLSLANLLPSLNVLDETEKEEFVATKINSIVTRRDAGTDEISTDEKVRSASRSFRQTFDVPVTERLVNCNSSFWKKKKKKEKMKYLIPVDFRSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.09
4 0.1
5 0.14
6 0.14
7 0.13
8 0.13
9 0.13
10 0.13
11 0.11
12 0.18
13 0.14
14 0.14
15 0.15
16 0.17
17 0.18
18 0.19
19 0.22
20 0.17
21 0.19
22 0.18
23 0.19
24 0.18
25 0.19
26 0.2
27 0.17
28 0.15
29 0.14
30 0.15
31 0.13
32 0.13
33 0.1
34 0.08
35 0.09
36 0.09
37 0.1
38 0.12
39 0.18
40 0.23
41 0.32
42 0.33
43 0.33
44 0.38
45 0.36
46 0.36
47 0.34
48 0.31
49 0.24
50 0.25
51 0.27
52 0.23
53 0.22
54 0.23
55 0.21
56 0.2
57 0.19
58 0.2
59 0.21
60 0.28
61 0.37
62 0.41
63 0.51
64 0.58
65 0.68
66 0.76
67 0.83
68 0.87
69 0.89
70 0.93
71 0.92
72 0.94
73 0.93
74 0.91
75 0.87
76 0.81