Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HQW9

Protein Details
Accession A0A1X2HQW9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-71LMYRGRHRGKKNKAKIPQNDTHydrophilic
NLS Segment(s)
PositionSequence
55-67GRHRGKKNKAKIP
Subcellular Location(s) cyto 11, cyto_nucl 10.333, cyto_mito 9.833, nucl 8.5, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003445  Cat_transpt  
Gene Ontology GO:0016020  C:membrane  
GO:0008324  F:monoatomic cation transmembrane transporter activity  
GO:0030001  P:metal ion transport  
Pfam View protein in Pfam  
PF02386  TrkH  
Amino Acid Sequences MEPAKPVTALTILYECVSAFACSGSSPGYPNTFTSESGKFHTLSKIMVIILMYRGRHRGKKNKAKIPQNDTKKKGVCLLFCTGLPAAIDHAVLLPSEQLLEKEEREHEFRHRHSEAVKATTKARCHREYSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.11
5 0.09
6 0.08
7 0.07
8 0.07
9 0.07
10 0.08
11 0.09
12 0.08
13 0.09
14 0.12
15 0.14
16 0.15
17 0.16
18 0.21
19 0.21
20 0.22
21 0.24
22 0.25
23 0.24
24 0.27
25 0.28
26 0.22
27 0.22
28 0.24
29 0.2
30 0.18
31 0.16
32 0.14
33 0.12
34 0.12
35 0.1
36 0.08
37 0.09
38 0.11
39 0.11
40 0.11
41 0.17
42 0.2
43 0.26
44 0.34
45 0.42
46 0.51
47 0.61
48 0.7
49 0.74
50 0.79
51 0.81
52 0.81
53 0.79
54 0.77
55 0.77
56 0.76
57 0.71
58 0.69
59 0.62
60 0.55
61 0.53
62 0.48
63 0.39
64 0.34
65 0.34
66 0.28
67 0.25
68 0.26
69 0.2
70 0.17
71 0.15
72 0.11
73 0.09
74 0.08
75 0.08
76 0.06
77 0.06
78 0.06
79 0.05
80 0.05
81 0.04
82 0.04
83 0.05
84 0.05
85 0.05
86 0.08
87 0.1
88 0.11
89 0.14
90 0.17
91 0.2
92 0.23
93 0.26
94 0.31
95 0.38
96 0.41
97 0.47
98 0.45
99 0.45
100 0.43
101 0.49
102 0.45
103 0.44
104 0.45
105 0.39
106 0.43
107 0.46
108 0.52
109 0.53
110 0.56
111 0.54