Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HIE1

Protein Details
Accession A0A1X2HIE1   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28APSKTTEKKVKSGDKKRKVSRKETYSTYHydrophilic
NLS Segment(s)
PositionSequence
8-21KKVKSGDKKRKVSR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences APSKTTEKKVKSGDKKRKVSRKETYSTYIYRVLKQVHPDTGISNKAMSILNSFVNDIFERIASEASKLAAYNKRSTISSREVQTAVRLILPGELAKHAVSEGTKAVTKYTSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.89
3 0.91
4 0.91
5 0.89
6 0.88
7 0.88
8 0.85
9 0.81
10 0.76
11 0.71
12 0.67
13 0.6
14 0.53
15 0.5
16 0.43
17 0.39
18 0.37
19 0.36
20 0.33
21 0.38
22 0.38
23 0.33
24 0.32
25 0.31
26 0.28
27 0.28
28 0.26
29 0.2
30 0.17
31 0.14
32 0.14
33 0.14
34 0.12
35 0.1
36 0.1
37 0.1
38 0.1
39 0.11
40 0.09
41 0.1
42 0.09
43 0.08
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.11
56 0.16
57 0.19
58 0.22
59 0.24
60 0.25
61 0.26
62 0.28
63 0.3
64 0.3
65 0.32
66 0.31
67 0.32
68 0.31
69 0.3
70 0.3
71 0.26
72 0.21
73 0.16
74 0.14
75 0.11
76 0.11
77 0.11
78 0.1
79 0.09
80 0.09
81 0.1
82 0.1
83 0.1
84 0.09
85 0.1
86 0.1
87 0.11
88 0.11
89 0.13
90 0.16
91 0.16
92 0.18
93 0.18