Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HGR7

Protein Details
Accession A0A1X2HGR7    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-35SSASGGKKAKKKWSAKKVKDKANNMVVHydrophilic
NLS Segment(s)
PositionSequence
13-28GGKKAKKKWSAKKVKD
Subcellular Location(s) nucl 19, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MGKKDQVPSSASGGKKAKKKWSAKKVKDKANNMVVLDKPTYERLFKEVPTYKFISQSVLVDRMRMNGSLARVAIRELEAQGVIKRLVHTRGQLIYTRATGDEKKTAGVESDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.54
4 0.58
5 0.62
6 0.72
7 0.75
8 0.79
9 0.84
10 0.88
11 0.92
12 0.9
13 0.91
14 0.9
15 0.85
16 0.83
17 0.79
18 0.71
19 0.61
20 0.55
21 0.46
22 0.39
23 0.33
24 0.24
25 0.18
26 0.18
27 0.19
28 0.17
29 0.17
30 0.18
31 0.2
32 0.2
33 0.27
34 0.3
35 0.3
36 0.33
37 0.36
38 0.33
39 0.33
40 0.32
41 0.27
42 0.2
43 0.2
44 0.17
45 0.19
46 0.18
47 0.16
48 0.16
49 0.16
50 0.16
51 0.15
52 0.14
53 0.11
54 0.12
55 0.12
56 0.12
57 0.11
58 0.1
59 0.1
60 0.1
61 0.09
62 0.09
63 0.08
64 0.09
65 0.08
66 0.09
67 0.1
68 0.11
69 0.1
70 0.1
71 0.12
72 0.14
73 0.17
74 0.2
75 0.21
76 0.24
77 0.27
78 0.28
79 0.3
80 0.29
81 0.28
82 0.26
83 0.25
84 0.22
85 0.23
86 0.23
87 0.25
88 0.28
89 0.26
90 0.27
91 0.26
92 0.26
93 0.24