Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HFY4

Protein Details
Accession A0A1X2HFY4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MAKKQKKESKTDQLKPKTEDASVKKKEPKKPKTKKTKTEKIAGLBasic
NLS Segment(s)
PositionSequence
4-41KQKKESKTDQLKPKTEDASVKKKEPKKPKTKKTKTEKI
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019327  WKF  
Pfam View protein in Pfam  
PF10180  WKF  
Amino Acid Sequences MAKKQKKESKTDQLKPKTEDASVKKKEPKKPKTKKTKTEKIAGLAQRKQEGAIEYLHTFVHKRDDWKFNKKKQTWLLHNMYKPSKMDDKDFELMVEYLEGLQGQARKAALDDALERKKLVEDHDEEDENTVTKERAQAIIDVLQDKEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.75
4 0.67
5 0.6
6 0.6
7 0.56
8 0.57
9 0.56
10 0.59
11 0.62
12 0.66
13 0.72
14 0.74
15 0.78
16 0.79
17 0.84
18 0.87
19 0.9
20 0.93
21 0.94
22 0.93
23 0.93
24 0.88
25 0.86
26 0.79
27 0.72
28 0.7
29 0.66
30 0.63
31 0.55
32 0.52
33 0.45
34 0.41
35 0.36
36 0.3
37 0.25
38 0.18
39 0.16
40 0.15
41 0.13
42 0.14
43 0.14
44 0.12
45 0.11
46 0.1
47 0.16
48 0.15
49 0.19
50 0.24
51 0.34
52 0.4
53 0.51
54 0.59
55 0.61
56 0.7
57 0.68
58 0.71
59 0.7
60 0.72
61 0.68
62 0.67
63 0.66
64 0.61
65 0.61
66 0.57
67 0.5
68 0.43
69 0.37
70 0.32
71 0.31
72 0.27
73 0.29
74 0.27
75 0.31
76 0.31
77 0.3
78 0.26
79 0.21
80 0.2
81 0.16
82 0.13
83 0.07
84 0.05
85 0.05
86 0.05
87 0.03
88 0.05
89 0.07
90 0.07
91 0.09
92 0.09
93 0.09
94 0.1
95 0.11
96 0.1
97 0.1
98 0.13
99 0.19
100 0.23
101 0.23
102 0.23
103 0.22
104 0.24
105 0.24
106 0.25
107 0.25
108 0.25
109 0.28
110 0.33
111 0.34
112 0.31
113 0.32
114 0.29
115 0.21
116 0.18
117 0.16
118 0.12
119 0.12
120 0.16
121 0.16
122 0.19
123 0.19
124 0.2
125 0.22
126 0.25
127 0.26
128 0.24
129 0.22