Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2H0X0

Protein Details
Accession A0A1X2H0X0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
20-68SNKSFRTKVKLGKKQKQNRPLPHWFRMKADTKIRWNAKRRNWRHTKLNIHydrophilic
NLS Segment(s)
PositionSequence
20-63SNKSFRTKVKLGKKQKQNRPLPHWFRMKADTKIRWNAKRRNWRH
Subcellular Location(s) nucl 19, mito_nucl 12.333, cyto_nucl 11.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MDGLLDDIDLLRNKQRHLPSNKSFRTKVKLGKKQKQNRPLPHWFRMKADTKIRWNAKRRNWRHTKLNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.36
3 0.42
4 0.5
5 0.58
6 0.6
7 0.69
8 0.73
9 0.72
10 0.69
11 0.65
12 0.63
13 0.59
14 0.6
15 0.6
16 0.63
17 0.68
18 0.73
19 0.78
20 0.81
21 0.84
22 0.85
23 0.84
24 0.83
25 0.81
26 0.83
27 0.8
28 0.78
29 0.77
30 0.68
31 0.62
32 0.6
33 0.58
34 0.55
35 0.56
36 0.56
37 0.55
38 0.63
39 0.68
40 0.7
41 0.74
42 0.76
43 0.77
44 0.81
45 0.82
46 0.83
47 0.85
48 0.84