Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HJA5

Protein Details
Accession A0A1X2HJA5    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-31VAIPGTNQKKRPRRRYDEIERLYHHydrophilic
57-78GPKRHPSEFKEMRKEWRRQKKEBasic
NLS Segment(s)
PositionSequence
57-78GPKRHPSEFKEMRKEWRRQKKE
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences ADKIYSFVAIPGTNQKKRPRRRYDEIERLYHCNWPGCTKSYGTLNHLNAHVSMQKHGPKRHPSEFKEMRKEWRRQKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.51
3 0.58
4 0.69
5 0.78
6 0.79
7 0.8
8 0.84
9 0.88
10 0.88
11 0.89
12 0.84
13 0.79
14 0.71
15 0.66
16 0.57
17 0.5
18 0.41
19 0.33
20 0.29
21 0.26
22 0.25
23 0.23
24 0.24
25 0.21
26 0.22
27 0.23
28 0.24
29 0.25
30 0.29
31 0.28
32 0.28
33 0.28
34 0.27
35 0.22
36 0.22
37 0.21
38 0.15
39 0.15
40 0.18
41 0.24
42 0.3
43 0.36
44 0.43
45 0.49
46 0.56
47 0.65
48 0.69
49 0.68
50 0.72
51 0.77
52 0.78
53 0.79
54 0.75
55 0.76
56 0.76
57 0.8
58 0.8