Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J0CV43

Protein Details
Accession J0CV43    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
102-128IQLQLPPPKRRRGRRVKRVPTQKKWLLHydrophilic
NLS Segment(s)
PositionSequence
108-122PPKRRRGRRVKRVPT
Subcellular Location(s) mito 13, nucl 6, cyto 5, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR041320  CxC1  
KEGG adl:AURDEDRAFT_176675  -  
Pfam View protein in Pfam  
PF18802  CxC1  
Amino Acid Sequences MPTMPAAAASIPFRRRNAPYRPRGAGQGVYVVSRREQQARNKTLRPPTRRASSPVSHDHEPVLPRPAQVPAPMTAPQPATADDDVFMADVGELPPTQPNYTIQLQLPPPKRRRGRRVKRVPTQKKWLLYQRWDDLLPKLQQPLLEHMAGRPPRQCPRCTVPGCAESLRRVTCVEWDKYTDQHFVCCPHNPLAAQLIARGFFPSSPELPTYAFSMKLLDFIIIYLGFVLRLSSLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.51
4 0.59
5 0.63
6 0.66
7 0.7
8 0.73
9 0.69
10 0.67
11 0.63
12 0.54
13 0.45
14 0.4
15 0.32
16 0.29
17 0.28
18 0.23
19 0.21
20 0.22
21 0.24
22 0.26
23 0.32
24 0.41
25 0.5
26 0.58
27 0.64
28 0.65
29 0.69
30 0.72
31 0.75
32 0.73
33 0.7
34 0.69
35 0.69
36 0.68
37 0.65
38 0.63
39 0.58
40 0.57
41 0.58
42 0.56
43 0.5
44 0.47
45 0.44
46 0.4
47 0.36
48 0.32
49 0.28
50 0.23
51 0.21
52 0.22
53 0.22
54 0.2
55 0.2
56 0.2
57 0.16
58 0.18
59 0.19
60 0.19
61 0.19
62 0.18
63 0.17
64 0.16
65 0.16
66 0.16
67 0.15
68 0.15
69 0.13
70 0.12
71 0.11
72 0.1
73 0.08
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.07
82 0.08
83 0.08
84 0.09
85 0.1
86 0.14
87 0.16
88 0.18
89 0.16
90 0.19
91 0.21
92 0.28
93 0.35
94 0.38
95 0.42
96 0.49
97 0.57
98 0.62
99 0.7
100 0.74
101 0.77
102 0.81
103 0.87
104 0.88
105 0.89
106 0.91
107 0.91
108 0.87
109 0.85
110 0.79
111 0.71
112 0.67
113 0.66
114 0.61
115 0.56
116 0.54
117 0.47
118 0.44
119 0.41
120 0.37
121 0.3
122 0.3
123 0.26
124 0.22
125 0.2
126 0.19
127 0.2
128 0.2
129 0.23
130 0.2
131 0.19
132 0.18
133 0.17
134 0.24
135 0.24
136 0.25
137 0.22
138 0.24
139 0.33
140 0.37
141 0.38
142 0.38
143 0.43
144 0.51
145 0.5
146 0.5
147 0.46
148 0.44
149 0.46
150 0.41
151 0.36
152 0.29
153 0.32
154 0.28
155 0.24
156 0.22
157 0.2
158 0.25
159 0.29
160 0.3
161 0.27
162 0.31
163 0.31
164 0.34
165 0.37
166 0.35
167 0.29
168 0.28
169 0.28
170 0.28
171 0.29
172 0.3
173 0.31
174 0.29
175 0.31
176 0.29
177 0.28
178 0.28
179 0.27
180 0.23
181 0.21
182 0.19
183 0.16
184 0.16
185 0.15
186 0.12
187 0.1
188 0.13
189 0.15
190 0.15
191 0.18
192 0.18
193 0.19
194 0.2
195 0.21
196 0.22
197 0.2
198 0.19
199 0.16
200 0.18
201 0.17
202 0.17
203 0.16
204 0.12
205 0.11
206 0.1
207 0.12
208 0.09
209 0.09
210 0.08
211 0.07
212 0.07
213 0.07
214 0.07