Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2H6K9

Protein Details
Accession A0A1X2H6K9    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-106GLAEPPKGGRKQRKEKKNRAKKFRGTAKAKASAGBasic
NLS Segment(s)
PositionSequence
75-108AEPPKGGRKQRKEKKNRAKKFRGTAKAKASAGKK
Subcellular Location(s) mito 13, cyto 9.5, cyto_nucl 7, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MVVDVLHPGLATISRDAIREKIAKMYKTEKDFVSVFGFKTQFGGGKTTGFGLIYDSVESLKKFEPKYRLVRLGLAEPPKGGRKQRKEKKNRAKKFRGTAKAKASAGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.17
5 0.21
6 0.23
7 0.23
8 0.28
9 0.33
10 0.34
11 0.37
12 0.43
13 0.45
14 0.47
15 0.49
16 0.4
17 0.39
18 0.37
19 0.35
20 0.32
21 0.27
22 0.22
23 0.24
24 0.23
25 0.19
26 0.2
27 0.18
28 0.15
29 0.14
30 0.16
31 0.12
32 0.12
33 0.13
34 0.12
35 0.11
36 0.09
37 0.08
38 0.07
39 0.07
40 0.07
41 0.07
42 0.06
43 0.07
44 0.08
45 0.08
46 0.08
47 0.1
48 0.14
49 0.16
50 0.21
51 0.26
52 0.32
53 0.4
54 0.45
55 0.48
56 0.45
57 0.47
58 0.43
59 0.41
60 0.39
61 0.34
62 0.28
63 0.23
64 0.25
65 0.26
66 0.3
67 0.35
68 0.4
69 0.48
70 0.59
71 0.68
72 0.77
73 0.83
74 0.9
75 0.93
76 0.94
77 0.94
78 0.93
79 0.94
80 0.93
81 0.92
82 0.92
83 0.91
84 0.87
85 0.85
86 0.83
87 0.81
88 0.73