Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2H5Y6

Protein Details
Accession A0A1X2H5Y6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-84MELIKNSKDKRAKKLTKRRLGTFVRHydrophilic
NLS Segment(s)
PositionSequence
65-88NSKDKRAKKLTKRRLGTFVRAKRK
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAPQQKSGIAVGLNKGHITTRRELPIKVSRKKGMLTQRTALVRGIIREVAGFAPYERRVMELIKNSKDKRAKKLTKRRLGTFVRAKRKIEELTGVIAESRRHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.24
5 0.26
6 0.28
7 0.31
8 0.38
9 0.4
10 0.4
11 0.44
12 0.48
13 0.53
14 0.55
15 0.56
16 0.52
17 0.53
18 0.54
19 0.54
20 0.55
21 0.53
22 0.51
23 0.46
24 0.47
25 0.46
26 0.45
27 0.38
28 0.3
29 0.22
30 0.18
31 0.17
32 0.12
33 0.1
34 0.09
35 0.1
36 0.07
37 0.07
38 0.06
39 0.05
40 0.08
41 0.09
42 0.1
43 0.09
44 0.1
45 0.11
46 0.12
47 0.16
48 0.21
49 0.27
50 0.31
51 0.39
52 0.38
53 0.46
54 0.52
55 0.54
56 0.56
57 0.61
58 0.66
59 0.7
60 0.81
61 0.84
62 0.85
63 0.87
64 0.82
65 0.81
66 0.76
67 0.75
68 0.74
69 0.73
70 0.74
71 0.73
72 0.7
73 0.64
74 0.64
75 0.58
76 0.51
77 0.47
78 0.38
79 0.36
80 0.34
81 0.31
82 0.25
83 0.24