Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HBL4

Protein Details
Accession A0A1X2HBL4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MGTVMRTPQQQKKKYPPTEIPTPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 12.5, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037197  WWE_dom_sf  
Amino Acid Sequences MGTVMRTPQQQKKKYPPTEIPTPIPTENNNSTNTNEPPLTDFPQEVTWLFFRDNQWTPFQNENHLKIEQAFTMGGIYVDIRDNNFPHLKSIRVFPARFYLSYLGMKYRLSCVIQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.82
4 0.79
5 0.81
6 0.77
7 0.7
8 0.63
9 0.59
10 0.52
11 0.45
12 0.39
13 0.36
14 0.36
15 0.34
16 0.34
17 0.31
18 0.31
19 0.34
20 0.33
21 0.29
22 0.24
23 0.21
24 0.22
25 0.24
26 0.25
27 0.21
28 0.2
29 0.18
30 0.19
31 0.19
32 0.15
33 0.14
34 0.11
35 0.12
36 0.12
37 0.13
38 0.13
39 0.18
40 0.21
41 0.21
42 0.24
43 0.24
44 0.27
45 0.3
46 0.29
47 0.31
48 0.33
49 0.34
50 0.34
51 0.32
52 0.29
53 0.24
54 0.25
55 0.17
56 0.14
57 0.11
58 0.07
59 0.07
60 0.07
61 0.06
62 0.05
63 0.05
64 0.04
65 0.06
66 0.06
67 0.07
68 0.1
69 0.1
70 0.16
71 0.19
72 0.19
73 0.23
74 0.24
75 0.26
76 0.25
77 0.29
78 0.33
79 0.37
80 0.37
81 0.34
82 0.4
83 0.41
84 0.39
85 0.39
86 0.32
87 0.29
88 0.32
89 0.31
90 0.26
91 0.25
92 0.26
93 0.24
94 0.25
95 0.25