Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HPA2

Protein Details
Accession A0A1X2HPA2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-30QYSMQQLFEKKRRRRESHNAVERRRRDNHydrophilic
NLS Segment(s)
PositionSequence
12-27KKRRRRESHNAVERRR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
PROSITE View protein in PROSITE  
PS50888  BHLH  
CDD cd11387  bHLHzip_USF_MITF  
Amino Acid Sequences ISQYSMQQLFEKKRRRRESHNAVERRRRDNINERINELATLLPDRDAIKANKGTILRKSVDHIRILHEKLGQYQHRIQELEGLLEVYRVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.82
4 0.84
5 0.86
6 0.86
7 0.89
8 0.87
9 0.85
10 0.87
11 0.83
12 0.78
13 0.72
14 0.64
15 0.61
16 0.62
17 0.64
18 0.64
19 0.59
20 0.55
21 0.51
22 0.48
23 0.4
24 0.3
25 0.2
26 0.11
27 0.1
28 0.08
29 0.06
30 0.07
31 0.08
32 0.08
33 0.11
34 0.11
35 0.15
36 0.17
37 0.17
38 0.2
39 0.21
40 0.23
41 0.24
42 0.27
43 0.24
44 0.23
45 0.27
46 0.31
47 0.32
48 0.33
49 0.31
50 0.32
51 0.37
52 0.38
53 0.37
54 0.32
55 0.29
56 0.3
57 0.38
58 0.35
59 0.35
60 0.39
61 0.41
62 0.43
63 0.43
64 0.38
65 0.37
66 0.35
67 0.31
68 0.26
69 0.21
70 0.17