Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1X2HSC0

Protein Details
Accession A0A1X2HSC0   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
88-109DIERYSDKYKQKKEKRGLNDISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024661  RNA_pol_III_Rpc31  
Gene Ontology GO:0005634  C:nucleus  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF11705  RNA_pol_3_Rpc31  
Amino Acid Sequences MSRGGFRGGRGGGGPQSGAMQLVSFDLLKDLGSGSLFNVQTALFPPADVPMPRKPTETESREWQLRDECLKMIRATPFHFVPPPPAPDIERYSDKYKQKKEKRGLNDISTDLDFFPEELQSILDPTKAKKRTFLNRFGTEGNGRKEEKKLTLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.13
3 0.14
4 0.13
5 0.12
6 0.09
7 0.07
8 0.06
9 0.07
10 0.08
11 0.06
12 0.06
13 0.06
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.13
23 0.13
24 0.12
25 0.13
26 0.12
27 0.12
28 0.14
29 0.15
30 0.08
31 0.08
32 0.09
33 0.09
34 0.12
35 0.12
36 0.15
37 0.19
38 0.25
39 0.26
40 0.28
41 0.28
42 0.32
43 0.41
44 0.41
45 0.38
46 0.39
47 0.43
48 0.44
49 0.43
50 0.38
51 0.31
52 0.29
53 0.28
54 0.23
55 0.19
56 0.18
57 0.19
58 0.18
59 0.18
60 0.18
61 0.17
62 0.18
63 0.2
64 0.19
65 0.18
66 0.19
67 0.17
68 0.2
69 0.2
70 0.21
71 0.19
72 0.19
73 0.19
74 0.22
75 0.24
76 0.23
77 0.24
78 0.26
79 0.3
80 0.36
81 0.42
82 0.47
83 0.54
84 0.61
85 0.67
86 0.74
87 0.78
88 0.8
89 0.8
90 0.82
91 0.79
92 0.72
93 0.65
94 0.56
95 0.5
96 0.4
97 0.33
98 0.23
99 0.17
100 0.13
101 0.1
102 0.09
103 0.07
104 0.07
105 0.06
106 0.07
107 0.06
108 0.08
109 0.08
110 0.1
111 0.11
112 0.15
113 0.24
114 0.3
115 0.31
116 0.37
117 0.45
118 0.54
119 0.61
120 0.68
121 0.68
122 0.66
123 0.69
124 0.63
125 0.59
126 0.56
127 0.55
128 0.5
129 0.47
130 0.45
131 0.45
132 0.48
133 0.49