Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1X2HLX1

Protein Details
Accession A0A1X2HLX1    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-37TKTHTLCRRCGKRSLHKQKKTCASCHydrophilic
NLS Segment(s)
PositionSequence
50-58SEKAKRRKT
Subcellular Location(s) nucl 9, mito 9, cyto 9, cyto_nucl 9, cyto_mito 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MTKGTTSFGKRQTKTHTLCRRCGKRSLHKQKKTCASCGYPAAKIRKFNWSEKAKRRKTTGTGRMSYLKKVHRRFLNGFREGTQAKKAVAATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.7
4 0.67
5 0.74
6 0.78
7 0.78
8 0.72
9 0.75
10 0.74
11 0.74
12 0.79
13 0.82
14 0.82
15 0.83
16 0.85
17 0.85
18 0.86
19 0.78
20 0.72
21 0.66
22 0.59
23 0.53
24 0.53
25 0.47
26 0.4
27 0.41
28 0.43
29 0.39
30 0.4
31 0.37
32 0.4
33 0.41
34 0.42
35 0.46
36 0.48
37 0.54
38 0.6
39 0.7
40 0.68
41 0.7
42 0.71
43 0.68
44 0.68
45 0.69
46 0.69
47 0.67
48 0.61
49 0.59
50 0.61
51 0.56
52 0.53
53 0.49
54 0.48
55 0.49
56 0.52
57 0.58
58 0.57
59 0.64
60 0.66
61 0.7
62 0.71
63 0.66
64 0.62
65 0.55
66 0.55
67 0.48
68 0.44
69 0.39
70 0.32
71 0.28
72 0.29